close

SimulationCraft 815-02

for World of Warcraft 8.2.0 PTR (wow build level 30329)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-05-15 Real Procs Per Minute data removed from Killing Machine.
Killing Machine rppm 4.50 0.00
2019-03-12 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-01-07 Incorrect Maelstrom generation value for Chain Lightning Overloads.
Fulmination (effect#6) base_value 2.00 3.00

The Crucible of Flame

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-06-23 Correct Ancient Flame rank 2 upgrade.
Ancient Flame (effect#1) base_value 35.00 25.00
2019-06-23 Correct Ancient Flame base damage.
Ancient Flame (effect#3) coefficient 1.23 2.28

Table of Contents

Raid Summary

 

Created with Highcharts 4.2.3 Damage per Second40,977 (5.87%)40,352 (4.26%)40,237 (3.96%)40,229 (3.94%)40,211 (3.90%)40,180 (3.81%)40,074 (3.54%)39,830 (2.91%)39,774 (2.76%)39,737 (2.67%)39,419 (1.85%)38,704worldveinlucid dreamscrucible of flameconflict+strifefocusing irislife-forceripple in spaceunbound forceblood of the enemyvisionspurification protocolbasebaseMaximum: 43,054.7Upper quartile: 39,498.6Mean: 38,703.9Median: 38,641.8Lower quartile: 37,853.9Minimum: 35,320.3

Actions per Minute / DPS Variance Summary

base : 38704 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
38703.9 38703.9 37.3 / 0.096% 4658.7 / 12.0% 4685.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.2 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
base 38704
Fury of Elune 886 2.3% 5.4 60.77sec 49406 50085 Direct 133.5 1680 3354 1989 18.4%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.37 133.51 143.71 0.00 0.9866 0.2957 265501.66 265501.66 0.00 5555.36 50085.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 108.89 81.56% 1679.72 1457 1987 1681.03 1581 1818 182910 182910 0.00
crit 24.62 18.44% 3354.27 2915 3974 3356.98 3002 3821 82592 82592 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 299 (427) 0.8% (1.1%) 8.3 33.28sec 15509 0 Direct 8.3 9126 18245 10866 19.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.27 8.27 0.00 0.00 0.0000 0.0000 89838.16 89838.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 80.90% 9125.76 8921 9813 9122.91 0 9813 61035 61035 0.00
crit 1.58 19.10% 18244.88 17842 19626 14635.70 0 19626 28803 28803 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 128 0.3% 8.3 33.28sec 4642 0 Direct 8.3 3911 7820 4642 18.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.27 8.27 0.00 0.00 0.0000 0.0000 38376.29 38376.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 81.30% 3910.92 3823 4206 3909.40 0 4206 26284 26284 0.00
crit 1.55 18.70% 7820.24 7646 8411 6295.53 0 8411 12093 12093 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5981 15.5% 79.7 3.74sec 22556 17342 Direct 79.7 19021 38029 22555 18.6%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.65 79.65 0.00 0.00 1.3006 0.0000 1796598.28 1796598.28 0.00 17342.02 17342.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.84 81.40% 19021.44 10135 24211 19028.27 18435 20095 1233354 1233354 0.00
crit 14.81 18.60% 38029.11 20270 48422 38044.22 34612 43248 563245 563245 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3145 8.1% 14.1 21.39sec 66992 66794 Direct 14.1 3611 7222 4284 18.6%  
Periodic 224.2 3325 6645 3944 18.6% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.10 14.10 224.20 224.20 1.0030 1.3317 944538.46 944538.46 0.00 3020.48 66794.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.47 81.37% 3611.44 3280 4472 3613.93 3338 3978 41433 41433 0.00
crit 2.63 18.63% 7222.49 6559 8943 6824.75 0 8943 18970 18970 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.4 81.36% 3324.50 4 4163 3325.91 3236 3464 606440 606440 0.00
crit 41.8 18.64% 6645.34 178 8327 6647.47 6270 7119 277695 277695 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 3488 (5453) 9.0% (14.1%) 101.6 2.90sec 16114 17646 Direct 102.2 8651 17306 10258 18.6%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.64 102.16 0.00 0.00 0.9132 0.0000 1047924.82 1047924.82 0.00 17645.80 17645.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.19 81.43% 8651.02 7949 10838 8655.43 8363 9119 719704 719704 0.00
crit 18.97 18.57% 17305.91 15898 21676 17313.23 15898 19236 328221 328221 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1964 5.1% 75.9 3.86sec 7774 0 Direct 75.9 7774 0 7774 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.89 75.89 0.00 0.00 0.0000 0.0000 589975.58 589975.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.89 100.00% 7773.50 5962 16257 7778.21 6711 8952 589976 589976 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 13700 35.4% 62.0 4.88sec 66377 63742 Direct 61.8 56132 112216 66594 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.98 61.78 0.00 0.00 1.0414 0.0000 4113880.97 4113880.97 0.00 63741.57 63741.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.25 81.35% 56132.13 51347 69612 56155.24 54294 58790 2820852 2820852 0.00
crit 11.52 18.65% 112216.02 102695 139223 112254.40 102695 127265 1293029 1293029 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 5929 15.3% 91.2 3.08sec 19432 0 Direct 91.2 16385 32767 19432 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.16 91.16 0.00 0.00 0.0000 0.0000 1771363.36 1771363.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.20 81.40% 16385.12 16021 17623 16384.66 16021 17264 1215776 1215776 0.00
crit 16.96 18.60% 32767.21 32042 35246 32768.62 32042 35017 555587 555587 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3185 8.2% 17.9 16.72sec 53354 52404 Direct 17.9 4509 9025 5348 18.6%  
Periodic 223.5 3247 6488 3852 18.7% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.93 17.93 223.48 223.48 1.0181 1.3320 956747.45 956747.45 0.00 3028.26 52404.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.60 81.42% 4509.16 4112 5607 4510.03 4152 4794 65837 65837 0.00
crit 3.33 18.58% 9025.01 8225 11214 8781.05 0 11214 30066 30066 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.8 81.33% 3246.99 7 4065 3248.35 3163 3397 590199 590199 0.00
crit 41.7 18.67% 6487.88 4 8130 6491.01 6104 7000 270646 270646 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
base
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.61sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.40sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9067 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.5 43.9sec 4.9sec 92.62% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:12.28%
  • arcanic_pulsar_2:10.15%
  • arcanic_pulsar_3:11.15%
  • arcanic_pulsar_4:10.64%
  • arcanic_pulsar_5:13.03%
  • arcanic_pulsar_6:11.53%
  • arcanic_pulsar_7:11.16%
  • arcanic_pulsar_8:12.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.6sec 0.0sec 16.17% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.09% 7.67% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.48% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 38.0sec 38.0sec 25.96% 35.88% 0.0(0.0) 8.0

Buff details

  • buff initial source:base
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.2sec 45.6sec 23.66% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:base
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.4 0.0 60.8sec 60.8sec 14.15% 0.00% 85.0(85.0) 5.2

Buff details

  • buff initial source:base
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.24% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:base
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 40.8 41.8 7.5sec 3.6sec 77.89% 99.79% 1.8(1.8) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:38.54%
  • lunar_empowerment_2:26.12%
  • lunar_empowerment_3:13.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.5sec 33.9sec 48.01% 0.00% 3.5(48.3) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.51%
  • overwhelming_power_23:2.59%
  • overwhelming_power_24:2.66%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 29.5 48.5 10.2sec 3.9sec 82.39% 74.42% 0.1(0.1) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:33.63%
  • solar_empowerment_2:35.94%
  • solar_empowerment_3:12.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.7 20.3sec 4.9sec 97.66% 92.87% 16.5(16.5) 12.0

Buff details

  • buff initial source:base
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.72%
  • starlord_2:22.33%
  • starlord_3:59.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.8sec 45.4sec 23.67% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:base
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.67%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:base
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:base
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:base
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
base
starsurge Astral Power 62.0 2479.1 40.0 40.0 1659.4
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 102.64 820.75 (33.61%) 8.00 0.41 0.05%
celestial_alignment Astral Power 2.00 80.00 (3.28%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.95 212.38 (8.70%) 2.50 0.00 0.00%
sunfire Astral Power 17.93 53.80 (2.20%) 3.00 0.00 0.00%
moonfire Astral Power 14.10 42.30 (1.73%) 3.00 0.00 0.00%
lunar_strike Astral Power 79.65 955.49 (39.13%) 12.00 0.33 0.03%
natures_balance Astral Power 401.52 200.74 (8.22%) 0.50 0.02 0.01%
arcanic_pulsar Astral Power 6.37 76.40 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.12 8.24
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.80 0.00 65.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data base Fight Length
Count 3985
Mean 300.77
Minimum 240.06
Maximum 359.83
Spread ( max - min ) 119.77
Range [ ( max - min ) / 2 * 100% ] 19.91%
DPS
Sample Data base Damage Per Second
Count 3985
Mean 38703.88
Minimum 35320.27
Maximum 43054.71
Spread ( max - min ) 7734.45
Range [ ( max - min ) / 2 * 100% ] 9.99%
Standard Deviation 1200.0606
5th Percentile 36812.47
95th Percentile 40771.57
( 95th Percentile - 5th Percentile ) 3959.10
Mean Distribution
Standard Deviation 19.0103
95.00% Confidence Intervall ( 38666.62 - 38741.14 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3694
0.1 Scale Factor Error with Delta=300 12294
0.05 Scale Factor Error with Delta=300 49176
0.01 Scale Factor Error with Delta=300 1229392
Priority Target DPS
Sample Data base Priority Target Damage Per Second
Count 3985
Mean 38703.88
Minimum 35320.27
Maximum 43054.71
Spread ( max - min ) 7734.45
Range [ ( max - min ) / 2 * 100% ] 9.99%
Standard Deviation 1200.0606
5th Percentile 36812.47
95th Percentile 40771.57
( 95th Percentile - 5th Percentile ) 3959.10
Mean Distribution
Standard Deviation 19.0103
95.00% Confidence Intervall ( 38666.62 - 38741.14 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3694
0.1 Scale Factor Error with Delta=300 12294
0.05 Scale Factor Error with Delta=300 49176
0.01 Scale Factor Error with Delta=300 1229392
DPS(e)
Sample Data base Damage Per Second (Effective)
Count 3985
Mean 38703.88
Minimum 35320.27
Maximum 43054.71
Spread ( max - min ) 7734.45
Range [ ( max - min ) / 2 * 100% ] 9.99%
Damage
Sample Data base Damage
Count 3985
Mean 11614745.01
Minimum 8998531.90
Maximum 14112312.51
Spread ( max - min ) 5113780.61
Range [ ( max - min ) / 2 * 100% ] 22.01%
DTPS
Sample Data base Damage Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data base Healing Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data base Healing Per Second (Effective)
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data base Heal
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data base Healing Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data baseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.37 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.37 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.98 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.03 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.87 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.75 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.23 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 80.01 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 101.92 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.16 sunfire

Sample Sequence

012345678ACDKONPHFGIKQKQKQPQKQPQKNQOQPQKQPQKLPPPKQPQKQPQMPQQPQKKNPQPKQPQKPQQPOQNKPPIKQPKQPQPQQKNQPKQKOPPKQPQKPQQNQQQOKPQKPQQQKPNQQQQQQKOGKIQPKQPKNPPKQPPQQQKPKOPQQNKPQQQKPQPQKPQONPKQPKQPLPQQQPKHEFIKQKOQPKQPNQPKQPQPQKPKPPKOQPKQPNPQQQQQKKPPKNQOPQKPQQQQPGQIKKNPQPPKOQPPPKQPQJKQKLPKQPPPKOQPQQQQKNPKPQQKPQQOPQQNQKIKQPKQPLQPKQPOPQQKKPQPKQPP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask base 58.0/100: 58% astral_power
Pre precombat 1 food base 58.0/100: 58% astral_power
Pre precombat 2 augmentation base 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.237 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.162 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.087 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.264 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.070 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.070 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.070 default I fury_of_elune Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.827 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.581 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.335 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.090 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.845 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.602 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.357 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.167 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.921 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.676 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.432 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.210 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.965 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.721 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.477 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.233 default O moonfire Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.987 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.742 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.567 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.322 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.076 default Q solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.830 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.672 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.427 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, ignition_mages_fuse(5)
0:24.182 default L sunfire Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:24.935 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:25.874 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2)
0:27.020 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2)
0:28.167 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(2)
0:29.068 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
0:29.824 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
0:30.794 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, celestial_alignment, solar_empowerment, starlord(3)
0:31.547 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, celestial_alignment, starlord(3)
0:32.310 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
0:33.066 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:34.036 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3)
0:34.797 default M moonfire Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3)
0:35.559 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3)
0:36.672 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, arcanic_pulsar, starlord(3)
0:37.548 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar, starlord(3)
0:38.422 default P lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3), conch_of_dark_whispers
0:39.536 default Q solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, arcanic_pulsar, starlord(3), conch_of_dark_whispers
0:40.411 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, conch_of_dark_whispers
0:41.365 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
0:42.569 default N sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:43.738 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:45.226 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers
0:46.218 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:47.707 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:48.875 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
0:49.844 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:51.291 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:52.256 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), conch_of_dark_whispers
0:53.392 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
0:54.838 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
0:55.802 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3)
0:56.768 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3)
0:58.215 default O moonfire Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3)
0:59.352 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3)
1:00.319 default N sunfire Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3)
1:01.455 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(5), lunar_empowerment
1:02.692 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(24)
1:04.098 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(22)
1:05.515 default I fury_of_elune Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, overwhelming_power(21)
1:06.630 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(2), starlord, overwhelming_power(20)
1:07.750 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(19)
1:08.676 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18)
1:10.069 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), overwhelming_power(16)
1:11.170 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15)
1:12.088 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
1:13.464 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(13)
1:14.384 default P lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12)
1:15.769 default Q solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(11)
1:16.696 default Q solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(10)
1:17.794 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(25)
1:18.832 default N sunfire Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24)
1:19.738 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23)
1:20.515 default P lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22)
1:21.678 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power celestial_alignment, torrent_of_elements, overwhelming_power(21)
1:22.678 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20)
1:23.504 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, overwhelming_power(19)
1:24.482 default O moonfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(18)
1:25.576 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(17)
1:26.976 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(16)
1:28.380 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(14)
1:29.491 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13)
1:30.414 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12)
1:31.800 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11)
1:32.728 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10)
1:33.822 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9)
1:35.221 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7)
1:36.163 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6)
1:37.109 default N sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, overwhelming_power(5)
1:38.226 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, overwhelming_power(4)
1:39.347 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(3)
1:40.472 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(2)
1:41.601 default O moonfire Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power
1:42.734 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(4)
1:43.971 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
1:45.502 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), solar_empowerment, starlord, conch_of_dark_whispers
1:46.523 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), starlord, conch_of_dark_whispers
1:47.727 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers
1:49.216 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), conch_of_dark_whispers
1:50.210 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), starlord(2), conch_of_dark_whispers
1:51.379 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), starlord(2), conch_of_dark_whispers
1:52.546 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), starlord(2), conch_of_dark_whispers
1:53.714 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
1:55.161 default N sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), conch_of_dark_whispers
1:56.298 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), conch_of_dark_whispers
1:57.265 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), starlord(3), conch_of_dark_whispers
1:58.402 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:59.538 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements
2:00.674 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements
2:01.813 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(25)
2:02.854 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(7), lunar_empowerment, torrent_of_elements, overwhelming_power(24)
2:03.992 default O moonfire Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
2:05.099 default G use_items Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
2:05.099 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers, ignition_mages_fuse
2:06.170 default I fury_of_elune Fluffy_Pillow 15.0/100: 15% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse
2:07.078 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse
2:07.852 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse
2:09.012 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse
2:09.929 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(2)
2:10.685 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.782 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.776 default N sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.773 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers, ignition_mages_fuse(3)
2:14.999 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.228 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.200 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers, ignition_mages_fuse(4)
2:17.998 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.194 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), ignition_mages_fuse(4)
2:20.398 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), ignition_mages_fuse(4)
2:21.202 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5), ignition_mages_fuse(5)
2:21.983 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(5), ignition_mages_fuse(5)
2:22.902 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(3), overwhelming_power(4), ignition_mages_fuse(5)
2:23.905 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(3), ignition_mages_fuse(5)
2:25.149 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), solar_empowerment, starlord, overwhelming_power
2:26.348 default O moonfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
2:27.516 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
2:29.004 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2)
2:29.997 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2)
2:30.991 default N sunfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), starlord(2)
2:32.158 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), starlord(2)
2:33.326 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3)
2:34.772 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
2:35.738 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
2:36.704 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), starlord(3)
2:37.838 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), starlord(3)
2:38.974 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3)
2:40.422 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
2:41.387 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(25)
2:42.713 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(24)
2:43.600 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), overwhelming_power(23)
2:44.740 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22)
2:46.157 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(20)
2:47.109 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, starlord, overwhelming_power(19)
2:48.232 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(8), lunar_empowerment, starlord, overwhelming_power(18)
2:49.357 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment, starlord, overwhelming_power(17)
2:50.797 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), starlord, overwhelming_power(16)
2:51.933 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(15)
2:52.752 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(14)
2:53.983 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power celestial_alignment, starlord(2), overwhelming_power(13)
2:54.953 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12)
2:55.756 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(11)
2:56.965 default L sunfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(10)
2:57.919 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(9)
2:59.320 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, starlord(3), overwhelming_power(7)
3:00.426 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, starlord(3), overwhelming_power(6)
3:01.537 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, starlord(3), overwhelming_power(5)
3:02.652 default P lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(4)
3:04.078 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar, overwhelming_power(2)
3:05.306 default H celestial_alignment Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power
3:06.348 default E potion Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord
3:06.348 default F berserking Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
3:06.348 default I fury_of_elune Fluffy_Pillow 81.0/100: 81% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
3:07.299 default K starsurge Fluffy_Pillow 84.0/100: 84% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
3:08.251 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:09.035 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect
3:09.961 default O moonfire Fluffy_Pillow 29.0/100: 29% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:10.861 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:11.626 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:12.771 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect
3:13.669 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:14.434 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:15.580 default N sunfire Fluffy_Pillow 58.0/100: 58% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:16.480 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:17.245 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:18.392 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect
3:19.381 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:20.223 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:21.481 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:22.322 default P lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:23.582 default Q solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), battle_potion_of_intellect
3:24.487 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect
3:25.475 default P lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect
3:26.884 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect
3:27.996 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:29.377 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
3:30.768 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect
3:31.865 default O moonfire Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
3:32.796 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers
3:33.589 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers
3:34.782 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
3:35.722 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
3:36.491 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers
3:37.647 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers
3:38.693 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers
3:40.030 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
3:40.928 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers
3:41.828 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar, starlord(3), overwhelming_power(19), conch_of_dark_whispers
3:42.890 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar, starlord(3), overwhelming_power(18)
3:43.954 default Q solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar, starlord(3), overwhelming_power(17)
3:45.022 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar, overwhelming_power(15)
3:46.193 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14)
3:47.335 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13)
3:48.755 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(12)
3:50.180 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(10)
3:51.306 default N sunfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(9)
3:52.405 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(8)
3:53.345 default O moonfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7)
3:54.454 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6)
3:55.870 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5)
3:56.819 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4)
3:57.938 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3)
3:59.371 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power
4:00.334 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements
4:01.299 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
4:02.436 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
4:03.572 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), torrent_of_elements
4:05.018 default G use_items Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
4:05.018 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, ignition_mages_fuse
4:06.107 default I fury_of_elune Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(5), lunar_empowerment, torrent_of_elements, ignition_mages_fuse
4:07.532 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(5), fury_of_elune, lunar_empowerment, ignition_mages_fuse
4:08.717 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord, ignition_mages_fuse
4:09.869 default N sunfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(2), ignition_mages_fuse(2)
4:10.942 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.308 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.220 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(3)
4:14.534 default P lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(3)
4:15.847 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.878 default O moonfire Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.883 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:18.704 default P lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.935 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.075 default P lunar_strike Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers, ignition_mages_fuse(5)
4:22.182 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(22), conch_of_dark_whispers, ignition_mages_fuse(5)
4:23.053 default Q solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21), conch_of_dark_whispers, ignition_mages_fuse(5)
4:23.808 default P lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.779 default Q solar_wrath Fluffy_Pillow 89.5/100: 90% astral_power celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.534 default J cancel_buff Fluffy_Pillow 98.0/100: 98% astral_power celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(19)
4:25.534 default K starsurge Fluffy_Pillow 98.0/100: 98% astral_power celestial_alignment, solar_empowerment, overwhelming_power(19)
4:26.540 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(18)
4:27.374 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17)
4:28.358 default L sunfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16)
4:29.317 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15)
4:30.725 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14)
4:31.835 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13)
4:32.755 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers
4:34.140 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
4:35.537 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers
4:36.938 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(8), conch_of_dark_whispers
4:38.042 default O moonfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(6), conch_of_dark_whispers
4:39.155 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(5), conch_of_dark_whispers
4:40.103 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4), conch_of_dark_whispers
4:41.530 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(3), conch_of_dark_whispers
4:42.482 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(2), conch_of_dark_whispers
4:43.442 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power, conch_of_dark_whispers
4:44.575 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:45.712 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(4), torrent_of_elements, conch_of_dark_whispers
4:46.950 default N sunfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
4:48.152 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
4:49.684 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), solar_empowerment, starlord, torrent_of_elements
4:50.888 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
4:52.375 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(2), torrent_of_elements
4:53.368 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), torrent_of_elements
4:54.362 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), torrent_of_elements
4:55.530 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
4:56.977 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements
4:57.943 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements
4:58.910 default O moonfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3)
5:00.046 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3)
5:01.494 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
5:02.460 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(7), starlord(3)
5:03.597 default N sunfire Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(7), starlord(3)
5:04.734 default Q solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(7), starlord(3)
5:05.872 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(7)
5:07.111 default I fury_of_elune Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
5:08.314 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment, starlord
5:09.514 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2)
5:10.381 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2)
5:11.678 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2)
5:12.696 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3)
5:13.537 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3)
5:14.795 default L sunfire Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3)
5:15.783 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3)
5:16.749 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3)
5:18.195 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3)
5:19.332 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3)
5:20.298 default P lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)
5:21.746 default O moonfire Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:22.883 default P lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:24.330 default Q solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:25.297 default Q solar_wrath Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), conch_of_dark_whispers
5:26.264 default K starsurge Fluffy_Pillow 99.5/100: 100% astral_power arcanic_pulsar(2), conch_of_dark_whispers
5:27.503 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
5:28.705 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
5:30.193 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers
5:31.186 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
5:32.674 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), conch_of_dark_whispers
5:33.743 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), conch_of_dark_whispers
5:34.630 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers
5:35.961 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="base"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

blood of the enemy : 39774 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
39773.8 39773.8 38.6 / 0.097% 4727.4 / 11.9% 4779.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.3 8.2 Astral Power 0.00% 58.6 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
blood of the enemy 39774
Fury of Elune 906 2.3% 5.4 60.81sec 50601 51793 Direct 134.6 1678 3344 2019 20.5%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.37 134.61 144.64 0.00 0.9771 0.2935 271758.64 271758.64 0.00 5697.72 51793.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 107.07 79.54% 1677.80 1457 1987 1679.22 1583 1829 179646 179646 0.00
crit 27.54 20.46% 3344.19 2915 3974 3347.29 3069 3856 92112 92112 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 306 (436) 0.8% (1.1%) 8.3 32.80sec 15768 0 Direct 8.3 9127 18246 11057 21.2%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.31 8.31 0.00 0.00 0.0000 0.0000 91932.82 91932.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.55 78.82% 9127.22 8921 9813 9125.90 0 9813 59810 59810 0.00
crit 1.76 21.18% 18245.51 17842 19626 15297.51 0 19626 32123 32123 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 130 0.3% 8.3 32.80sec 4710 0 Direct 8.3 3911 7821 4710 20.4%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.31 8.31 0.00 0.00 0.0000 0.0000 39155.61 39155.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.62 79.58% 3911.40 3823 4206 3910.75 3823 4206 25877 25877 0.00
crit 1.70 20.42% 7821.45 7646 8411 6427.47 0 8411 13279 13279 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6153 15.5% 80.3 3.70sec 23024 17877 Direct 80.3 19033 38008 23024 21.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.30 80.30 0.00 0.00 1.2879 0.0000 1848792.27 1848792.27 0.00 17877.24 17877.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.41 78.97% 19033.25 10135 24211 19041.03 18313 19993 1206966 1206966 0.00
crit 16.89 21.03% 38007.68 20270 48422 38026.59 34659 44321 641826 641826 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3233 8.1% 14.1 21.44sec 68891 69138 Direct 14.1 3609 7208 4357 20.8%  
Periodic 226.1 3325 6644 4022 21.0% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.09 14.09 226.13 226.13 0.9965 1.3204 970840.51 970840.51 0.00 3105.49 69138.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.16 79.20% 3608.76 3280 4472 3610.86 3305 3921 40279 40279 0.00
crit 2.93 20.80% 7208.00 6559 8943 6907.77 0 8943 21128 21128 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.7 79.02% 3325.37 4 4163 3326.87 3235 3465 594203 594203 0.00
crit 47.4 20.98% 6644.46 8 8327 6646.58 6292 7164 315231 315231 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 3603 (5621) 9.1% (14.1%) 102.9 2.86sec 16403 18060 Direct 103.4 8655 17295 10466 21.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.95 103.44 0.00 0.00 0.9082 0.0000 1082555.23 1082555.23 0.00 18060.45 18060.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.76 79.04% 8655.18 7949 10838 8659.94 8397 9028 707618 707618 0.00
crit 21.68 20.96% 17294.81 15898 21676 17301.51 16042 18976 374937 374937 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2018 5.1% 76.3 3.84sec 7939 0 Direct 76.3 7939 0 7939 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.34 76.34 0.00 0.00 0.0000 0.0000 606060.28 606060.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.34 100.00% 7938.65 5962 16257 7943.81 6805 9114 606060 606060 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 14067 35.4% 62.4 4.85sec 67654 65496 Direct 62.2 56144 112128 67882 21.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.44 62.23 0.00 0.00 1.0330 0.0000 4224273.81 4224273.81 0.00 65495.66 65495.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.18 79.03% 56144.32 51347 69612 56170.88 54090 59061 2761294 2761294 0.00
crit 13.05 20.97% 112127.89 102695 139223 112164.80 102695 128188 1462980 1462980 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 6089 15.2% 91.8 3.06sec 19811 0 Direct 91.8 16388 32773 19811 20.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.84 91.84 0.00 0.00 0.0000 0.0000 1819318.93 1819318.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.65 79.11% 16387.52 16021 17623 16387.56 16021 17461 1190550 1190550 0.00
crit 19.19 20.89% 32773.15 32042 35246 32772.25 32042 34753 628769 628769 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3268 8.2% 17.8 16.84sec 55091 54517 Direct 17.8 4504 9009 5439 20.8%  
Periodic 225.3 3248 6488 3927 21.0% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.82 17.82 225.35 225.35 1.0106 1.3209 981789.13 981789.13 0.00 3110.23 54516.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.12 79.24% 4503.69 4112 5607 4504.69 4225 4820 63601 63601 0.00
crit 3.70 20.76% 9009.46 8225 11214 8841.01 0 11214 33325 33325 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.1 79.05% 3247.74 2 4065 3249.32 3150 3375 578526 578526 0.00
crit 47.2 20.95% 6487.76 31 8130 6489.98 6169 7047 306337 306337 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
blood of the enemy
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.86sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.65sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9034 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.9 43.6sec 4.9sec 92.58% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:12.23%
  • arcanic_pulsar_2:10.43%
  • arcanic_pulsar_3:11.18%
  • arcanic_pulsar_4:10.80%
  • arcanic_pulsar_5:12.79%
  • arcanic_pulsar_6:11.31%
  • arcanic_pulsar_7:11.86%
  • arcanic_pulsar_8:11.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.9sec 0.0sec 16.17% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.8sec 182.8sec 8.09% 7.53% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.48% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blood-Soaked 4.3 0.0 66.6sec 66.6sec 11.36% 0.00% 0.0(0.0) 4.2

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:631.87

Stack Uptimes

  • bloodsoaked_1:11.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297168
  • name:Blood-Soaked
  • tooltip:Haste increased by $w1. While active Blood of the Enemy stacks are not granted.
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Blood-Soaked (_counter) 4.1 175.7 77.6sec 1.7sec 88.61% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked_counter
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:9.69

Stack Uptimes

  • bloodsoaked_counter_1:2.69%
  • bloodsoaked_counter_2:2.40%
  • bloodsoaked_counter_3:2.23%
  • bloodsoaked_counter_4:2.15%
  • bloodsoaked_counter_5:2.03%
  • bloodsoaked_counter_6:2.02%
  • bloodsoaked_counter_7:1.97%
  • bloodsoaked_counter_8:1.92%
  • bloodsoaked_counter_9:1.90%
  • bloodsoaked_counter_10:5.27%
  • bloodsoaked_counter_11:2.44%
  • bloodsoaked_counter_12:2.43%
  • bloodsoaked_counter_13:2.43%
  • bloodsoaked_counter_14:2.38%
  • bloodsoaked_counter_15:2.36%
  • bloodsoaked_counter_16:2.36%
  • bloodsoaked_counter_17:2.31%
  • bloodsoaked_counter_18:2.31%
  • bloodsoaked_counter_19:2.31%
  • bloodsoaked_counter_20:2.26%
  • bloodsoaked_counter_21:2.28%
  • bloodsoaked_counter_22:2.23%
  • bloodsoaked_counter_23:2.24%
  • bloodsoaked_counter_24:2.21%
  • bloodsoaked_counter_25:2.17%
  • bloodsoaked_counter_26:2.18%
  • bloodsoaked_counter_27:2.15%
  • bloodsoaked_counter_28:2.15%
  • bloodsoaked_counter_29:2.15%
  • bloodsoaked_counter_30:2.14%
  • bloodsoaked_counter_31:2.11%
  • bloodsoaked_counter_32:2.10%
  • bloodsoaked_counter_33:2.09%
  • bloodsoaked_counter_34:2.09%
  • bloodsoaked_counter_35:2.07%
  • bloodsoaked_counter_36:2.04%
  • bloodsoaked_counter_37:2.04%
  • bloodsoaked_counter_38:2.00%
  • bloodsoaked_counter_39:1.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297162
  • name:Blood-Soaked
  • tooltip:$?a297177[Critical strike increased by $w2. ][]$@spellaura297147
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Celestial Alignment 8.1 0.0 38.5sec 38.5sec 26.07% 35.81% 0.0(0.0) 7.9

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.2sec 45.9sec 23.64% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.4 0.0 60.8sec 60.8sec 14.13% 0.00% 84.9(84.9) 5.2

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.24% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.80%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 41.3 42.0 7.4sec 3.6sec 77.75% 99.76% 1.8(1.8) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:38.61%
  • lunar_empowerment_2:25.92%
  • lunar_empowerment_3:13.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.2sec 33.6sec 48.27% 0.00% 3.5(49.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.59%
  • overwhelming_power_7:1.64%
  • overwhelming_power_8:1.68%
  • overwhelming_power_9:1.73%
  • overwhelming_power_10:1.78%
  • overwhelming_power_11:1.83%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.94%
  • overwhelming_power_14:2.00%
  • overwhelming_power_15:2.06%
  • overwhelming_power_16:2.12%
  • overwhelming_power_17:2.18%
  • overwhelming_power_18:2.24%
  • overwhelming_power_19:2.31%
  • overwhelming_power_20:2.38%
  • overwhelming_power_21:2.45%
  • overwhelming_power_22:2.53%
  • overwhelming_power_23:2.61%
  • overwhelming_power_24:2.68%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 29.8 48.6 10.1sec 3.8sec 82.05% 73.93% 0.1(0.1) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:33.75%
  • solar_empowerment_2:35.68%
  • solar_empowerment_3:12.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 47.2 20.3sec 4.8sec 97.66% 93.04% 17.0(17.0) 12.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.40%
  • starlord_2:22.39%
  • starlord_3:59.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.6sec 23.60% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.60%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
blood of the enemy
starsurge Astral Power 62.4 2497.6 40.0 40.0 1691.4
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 103.95 831.18 (33.79%) 8.00 0.38 0.05%
celestial_alignment Astral Power 2.00 80.00 (3.25%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.87 212.17 (8.62%) 2.50 0.01 0.00%
sunfire Astral Power 17.82 53.46 (2.17%) 3.00 0.00 0.00%
moonfire Astral Power 14.09 42.28 (1.72%) 3.00 0.00 0.00%
lunar_strike Astral Power 80.30 963.20 (39.15%) 11.99 0.42 0.04%
natures_balance Astral Power 401.52 200.74 (8.16%) 0.50 0.02 0.01%
arcanic_pulsar Astral Power 6.43 77.17 (3.14%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.18 8.30
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.97 0.00 67.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data blood of the enemy Fight Length
Count 3985
Mean 300.77
Minimum 240.06
Maximum 359.83
Spread ( max - min ) 119.77
Range [ ( max - min ) / 2 * 100% ] 19.91%
DPS
Sample Data blood of the enemy Damage Per Second
Count 3985
Mean 39773.84
Minimum 35895.74
Maximum 45008.51
Spread ( max - min ) 9112.78
Range [ ( max - min ) / 2 * 100% ] 11.46%
Standard Deviation 1242.9976
5th Percentile 37867.21
95th Percentile 41935.66
( 95th Percentile - 5th Percentile ) 4068.45
Mean Distribution
Standard Deviation 19.6905
95.00% Confidence Intervall ( 39735.25 - 39812.43 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3752
0.1 Scale Factor Error with Delta=300 13190
0.05 Scale Factor Error with Delta=300 52758
0.01 Scale Factor Error with Delta=300 1318938
Priority Target DPS
Sample Data blood of the enemy Priority Target Damage Per Second
Count 3985
Mean 39773.84
Minimum 35895.74
Maximum 45008.51
Spread ( max - min ) 9112.78
Range [ ( max - min ) / 2 * 100% ] 11.46%
Standard Deviation 1242.9976
5th Percentile 37867.21
95th Percentile 41935.66
( 95th Percentile - 5th Percentile ) 4068.45
Mean Distribution
Standard Deviation 19.6905
95.00% Confidence Intervall ( 39735.25 - 39812.43 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3752
0.1 Scale Factor Error with Delta=300 13190
0.05 Scale Factor Error with Delta=300 52758
0.01 Scale Factor Error with Delta=300 1318938
DPS(e)
Sample Data blood of the enemy Damage Per Second (Effective)
Count 3985
Mean 39773.84
Minimum 35895.74
Maximum 45008.51
Spread ( max - min ) 9112.78
Range [ ( max - min ) / 2 * 100% ] 11.46%
Damage
Sample Data blood of the enemy Damage
Count 3985
Mean 11936477.23
Minimum 9263342.95
Maximum 14698824.69
Spread ( max - min ) 5435481.73
Range [ ( max - min ) / 2 * 100% ] 22.77%
DTPS
Sample Data blood of the enemy Damage Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data blood of the enemy Healing Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data blood of the enemy Healing Per Second (Effective)
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data blood of the enemy Heal
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data blood of the enemy Healing Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data blood of the enemy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data blood of the enemyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data blood of the enemy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.37 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.26 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 62.44 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.92 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.78 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.75 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.31 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 80.65 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 103.20 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.15 sunfire

Sample Sequence

012345678ACDKONPHFGIKQKQKQPQKQPQKNQOQPQPKQPKLPPPQKQPKQPQKMPPQQQQKNPKQPQQKPQQQKOPNPQKIPPKPQKQPKQPLPOPQKPKQPQQKPQQNQKPQOQKPPQQKPQNQKPQQQQOGIKQKQPKQLPKPPPKQPPQPQOKPKNPQPKQPQQKPQQQPKNOQKQLPPKPQPQQHEFJKIKQPKNOQPKQPKQPQPQPPKKQPKQPLOQPPKQPPQQKKNPPQKOPQQQKPPQGQIKNPKPPKQPQKQPMPQNPQQKKPPKQPQOPKPNQPQQKPKPQQQQKPNOQQQQIKQKQPKLPKPPPKOQPPKQPQQKP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask blood of the enemy 58.0/100: 58% astral_power
Pre precombat 1 food blood of the enemy 58.0/100: 58% astral_power
Pre precombat 2 augmentation blood of the enemy 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.165 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:03.090 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:04.268 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, overwhelming_power(25), bloodsoaked_counter, battle_potion_of_intellect
0:05.023 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, overwhelming_power(24), bloodsoaked_counter, battle_potion_of_intellect
0:05.023 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, overwhelming_power(24), bloodsoaked_counter, battle_potion_of_intellect
0:05.023 default I fury_of_elune Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, overwhelming_power(24), bloodsoaked_counter, battle_potion_of_intellect, ignition_mages_fuse
0:05.780 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord, overwhelming_power(24), bloodsoaked_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.537 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23), bloodsoaked_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.290 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(22), bloodsoaked_counter(4), battle_potion_of_intellect, ignition_mages_fuse
0:08.045 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), bloodsoaked_counter(4), battle_potion_of_intellect, ignition_mages_fuse
0:08.800 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), bloodsoaked_counter(5), battle_potion_of_intellect, ignition_mages_fuse
0:09.554 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20), bloodsoaked_counter(5), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.309 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), bloodsoaked_counter(6), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.070 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18), bloodsoaked_counter(8), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.825 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), overwhelming_power(18), bloodsoaked_counter(8), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.579 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(17), bloodsoaked_counter(8), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.333 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(16), bloodsoaked_counter(9), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.088 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(15), bloodsoaked_counter(11), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.843 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(15), bloodsoaked_counter(13), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.598 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(14), bloodsoaked_counter(13), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.355 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(13), bloodsoaked_counter(14), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.109 default O moonfire Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(12), bloodsoaked_counter(15), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.865 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(12), bloodsoaked_counter(15), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.619 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(11), bloodsoaked_counter(17), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.416 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(10), bloodsoaked_counter(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.169 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), overwhelming_power(9), bloodsoaked_counter(21), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.042 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), overwhelming_power(8), bloodsoaked_counter(21), battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.796 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(8), bloodsoaked_counter(22), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.549 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(7), bloodsoaked_counter(23), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.374 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(6), bloodsoaked_counter(23), ignition_mages_fuse(5)
0:24.129 default L sunfire Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(5), bloodsoaked_counter(24), ignition_mages_fuse(5)
0:24.882 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(5), bloodsoaked_counter(24), ignition_mages_fuse(5)
0:25.807 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(4), bloodsoaked_counter(25)
0:26.935 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(3), bloodsoaked_counter(25)
0:28.069 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(3), starlord(2), overwhelming_power, bloodsoaked_counter(27)
0:28.829 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power, bloodsoaked_counter(27)
0:29.726 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(27)
0:30.482 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(27)
0:31.452 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, celestial_alignment, solar_empowerment(2), starlord(3), bloodsoaked_counter(28)
0:32.213 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(29)
0:32.967 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(30)
0:33.937 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), bloodsoaked_counter(31)
0:34.691 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(32)
0:35.453 default M moonfire Fluffy_Pillow 0.5/100: 1% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(33)
0:36.214 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(34)
0:37.329 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(34)
0:38.442 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, arcanic_pulsar(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(34)
0:39.197 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, arcanic_pulsar(2), solar_empowerment, starlord(3), bloodsoaked_counter(34), conch_of_dark_whispers
0:39.953 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar(2), starlord(3), bloodsoaked_counter(34), conch_of_dark_whispers
0:40.829 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar(2), starlord(3), bloodsoaked_counter(34), conch_of_dark_whispers
0:41.704 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(2), bloodsoaked_counter(34), conch_of_dark_whispers
0:42.943 default N sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(35), conch_of_dark_whispers
0:44.145 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(36), conch_of_dark_whispers
0:45.676 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, bloodsoaked_counter(37), conch_of_dark_whispers
0:46.879 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), bloodsoaked_counter(38), conch_of_dark_whispers
0:47.873 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(39), conch_of_dark_whispers
0:49.361 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:50.283 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:51.206 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), starlord(2), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:52.291 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:53.635 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:54.533 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), starlord(3), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:55.589 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:56.647 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:57.706 default O moonfire Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(10), conch_of_dark_whispers
0:58.842 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(11), conch_of_dark_whispers
1:00.289 default N sunfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), bloodsoaked_counter(11), conch_of_dark_whispers
1:01.332 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), bloodsoaked_counter(13), conch_of_dark_whispers
1:02.665 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), solar_empowerment, torrent_of_elements, overwhelming_power(22), bloodsoaked_counter(13)
1:03.639 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), lunar_empowerment, torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(14)
1:04.789 default I fury_of_elune Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20), bloodsoaked_counter(15)
1:06.145 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(18), bloodsoaked_counter(16)
1:07.579 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(20)
1:09.017 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(15), bloodsoaked_counter(21), conch_of_dark_whispers
1:10.157 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(14), bloodsoaked_counter(22), conch_of_dark_whispers
1:11.573 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(2), overwhelming_power(25), bloodsoaked_counter(23), conch_of_dark_whispers
1:12.481 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(24), bloodsoaked_counter(25), conch_of_dark_whispers
1:13.554 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked_counter(27), conch_of_dark_whispers
1:14.328 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), bloodsoaked_counter(29), conch_of_dark_whispers
1:15.491 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21), bloodsoaked_counter(29), conch_of_dark_whispers
1:16.408 default Q solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), bloodsoaked_counter(30), conch_of_dark_whispers
1:17.189 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), bloodsoaked_counter(31), conch_of_dark_whispers
1:18.365 default L sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), bloodsoaked_counter(31), conch_of_dark_whispers
1:19.292 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17), bloodsoaked_counter(33), conch_of_dark_whispers
1:20.653 default O moonfire Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16), bloodsoaked_counter(34), conch_of_dark_whispers
1:21.726 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), bloodsoaked_counter(35), conch_of_dark_whispers
1:23.098 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(13), bloodsoaked_counter(36), conch_of_dark_whispers
1:24.020 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar, solar_empowerment, overwhelming_power(12), bloodsoaked_counter(36)
1:25.206 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(11), bloodsoaked_counter(37)
1:26.678 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord, overwhelming_power(10), bloodsoaked_counter(39)
1:27.837 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(9), bloodsoaked_counter(10), bloodsoaked
1:28.731 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(8), bloodsoaked_counter(10), bloodsoaked
1:30.077 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(6), bloodsoaked_counter(10), bloodsoaked
1:30.981 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(6), bloodsoaked_counter(10), bloodsoaked
1:31.887 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), starlord(2), overwhelming_power(5), bloodsoaked_counter(10), bloodsoaked
1:32.954 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(4), bloodsoaked_counter(10), bloodsoaked
1:34.280 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(2), bloodsoaked_counter(10), bloodsoaked
1:35.173 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power, bloodsoaked_counter(10)
1:36.134 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), starlord(3), bloodsoaked_counter(11)
1:37.271 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), starlord(3), bloodsoaked_counter(11)
1:38.408 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(4), starlord(3), bloodsoaked_counter(13)
1:39.543 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(13)
1:40.991 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), bloodsoaked_counter(14)
1:41.958 default O moonfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), starlord(3), bloodsoaked_counter(14)
1:43.095 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), starlord(3), bloodsoaked_counter(16)
1:44.232 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment, bloodsoaked_counter(16)
1:45.469 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(16)
1:47.001 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(16)
1:48.533 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), solar_empowerment, starlord, bloodsoaked_counter(16)
1:49.554 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), starlord, bloodsoaked_counter(16)
1:50.756 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), starlord, bloodsoaked_counter(17)
1:51.958 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), bloodsoaked_counter(17)
1:53.447 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), bloodsoaked_counter(17)
1:54.441 default N sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), starlord(2), bloodsoaked_counter(18)
1:55.612 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), starlord(2), torrent_of_elements, bloodsoaked_counter(18)
1:56.780 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), starlord(2), torrent_of_elements, bloodsoaked_counter(18)
1:57.948 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(20)
1:59.397 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(21), conch_of_dark_whispers
2:00.363 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, bloodsoaked_counter(21), conch_of_dark_whispers
2:01.500 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, bloodsoaked_counter(22), conch_of_dark_whispers
2:02.638 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, bloodsoaked_counter(22), conch_of_dark_whispers
2:03.775 default O moonfire Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, bloodsoaked_counter(24), conch_of_dark_whispers
2:04.912 default G use_items Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), torrent_of_elements, bloodsoaked_counter(24), conch_of_dark_whispers
2:04.912 default I fury_of_elune Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), torrent_of_elements, bloodsoaked_counter(24), conch_of_dark_whispers, ignition_mages_fuse
2:06.211 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), fury_of_elune, torrent_of_elements, bloodsoaked_counter(27), conch_of_dark_whispers, ignition_mages_fuse
2:07.398 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(31), conch_of_dark_whispers, ignition_mages_fuse
2:08.249 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(34), conch_of_dark_whispers, ignition_mages_fuse
2:09.250 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked_counter(37), conch_of_dark_whispers, ignition_mages_fuse(2)
2:10.046 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), starlord(2), torrent_of_elements, bloodsoaked_counter(38), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.238 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.049 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.803 default L sunfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(23), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.594 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(22), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(3)
2:14.713 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), bloodsoaked, ignition_mages_fuse(3)
2:15.596 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), bloodsoaked, ignition_mages_fuse(3)
2:16.724 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), bloodsoaked, ignition_mages_fuse(3)
2:17.855 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), bloodsoaked, ignition_mages_fuse(4)
2:18.951 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), ignition_mages_fuse(4)
2:19.867 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(16), ignition_mages_fuse(4)
2:20.648 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), ignition_mages_fuse(4)
2:21.823 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), bloodsoaked_counter(2), ignition_mages_fuse(5)
2:22.961 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(13), bloodsoaked_counter(3), ignition_mages_fuse(5)
2:23.725 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), bloodsoaked_counter(3), ignition_mages_fuse(5)
2:24.867 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(11), bloodsoaked_counter(4), ignition_mages_fuse(5)
2:25.634 default O moonfire Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(10), bloodsoaked_counter(5)
2:26.729 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(4), overwhelming_power(9), bloodsoaked_counter(5)
2:27.928 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(8), bloodsoaked_counter(6)
2:29.415 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), solar_empowerment, starlord, overwhelming_power(6), bloodsoaked_counter(7)
2:30.592 default N sunfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(5), bloodsoaked_counter(7)
2:31.740 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), bloodsoaked_counter(8)
2:33.102 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(2), overwhelming_power(23), bloodsoaked_counter(8)
2:34.017 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), bloodsoaked_counter(8)
2:35.393 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(21), bloodsoaked_counter(8)
2:36.476 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(20), bloodsoaked_counter(8)
2:37.374 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), bloodsoaked_counter(8)
2:38.726 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), bloodsoaked_counter(8)
2:39.630 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(9)
2:40.538 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(16), bloodsoaked_counter(9)
2:41.610 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), bloodsoaked_counter(9)
2:42.981 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), bloodsoaked_counter(9)
2:43.897 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(13), bloodsoaked_counter(9)
2:44.980 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(12), bloodsoaked_counter(9)
2:46.067 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10), bloodsoaked_counter(9)
2:47.462 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), torrent_of_elements, overwhelming_power(9), bloodsoaked_counter(9)
2:48.661 default N sunfire Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(8), bloodsoaked_counter(9)
2:49.676 default O moonfire Fluffy_Pillow 32.0/100: 32% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(7), bloodsoaked_counter(9)
2:50.695 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(6), bloodsoaked_counter(9)
2:51.565 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(5), bloodsoaked_counter(10)
2:52.591 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(4), bloodsoaked_counter(10)
2:53.444 default L sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(3), bloodsoaked_counter(10)
2:54.450 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(2), overwhelming_power(2), bloodsoaked_counter(11)
2:55.928 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), overwhelming_power, bloodsoaked_counter(11)
2:57.409 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, starlord(2), bloodsoaked_counter(11)
2:58.577 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(12)
3:00.025 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), bloodsoaked_counter(13), conch_of_dark_whispers
3:00.993 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), bloodsoaked_counter(14), conch_of_dark_whispers
3:02.440 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), starlord(3), bloodsoaked_counter(14), conch_of_dark_whispers
3:03.575 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), starlord(3), bloodsoaked_counter(17), conch_of_dark_whispers
3:04.711 default H celestial_alignment Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(2), celestial_alignment, starlord(3), bloodsoaked_counter(18), conch_of_dark_whispers
3:05.698 default E potion Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(2), celestial_alignment, starlord(3), bloodsoaked_counter(19), conch_of_dark_whispers
3:05.698 default F berserking Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(2), celestial_alignment, starlord(3), bloodsoaked_counter(19), conch_of_dark_whispers, battle_potion_of_intellect
3:05.698 default J cancel_buff Fluffy_Pillow 96.5/100: 97% astral_power berserking, arcanic_pulsar(2), celestial_alignment, starlord(3), bloodsoaked_counter(19), conch_of_dark_whispers, battle_potion_of_intellect
3:05.698 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power berserking, arcanic_pulsar(2), celestial_alignment, bloodsoaked_counter(19), conch_of_dark_whispers, battle_potion_of_intellect
3:06.677 default I fury_of_elune Fluffy_Pillow 57.0/100: 57% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(22), conch_of_dark_whispers, battle_potion_of_intellect
3:07.629 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(25), conch_of_dark_whispers, battle_potion_of_intellect
3:08.582 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(27), conch_of_dark_whispers, battle_potion_of_intellect
3:09.370 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(2), bloodsoaked_counter(31), conch_of_dark_whispers, battle_potion_of_intellect
3:10.550 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), bloodsoaked_counter(33), conch_of_dark_whispers, battle_potion_of_intellect
3:11.474 default N sunfire Fluffy_Pillow 23.0/100: 23% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(36), conch_of_dark_whispers, battle_potion_of_intellect
3:12.373 default O moonfire Fluffy_Pillow 31.5/100: 32% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(38), conch_of_dark_whispers, battle_potion_of_intellect
3:13.270 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:14.024 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:15.086 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked, battle_potion_of_intellect
3:15.922 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked, battle_potion_of_intellect
3:16.676 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked, battle_potion_of_intellect
3:17.739 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked, battle_potion_of_intellect
3:18.659 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked, battle_potion_of_intellect
3:19.440 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked, battle_potion_of_intellect
3:20.609 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked, battle_potion_of_intellect
3:21.389 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:22.647 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:23.487 default P lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(2), battle_potion_of_intellect
3:24.746 default P lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(2), battle_potion_of_intellect
3:26.194 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(7), solar_empowerment, bloodsoaked_counter(2), battle_potion_of_intellect
3:27.432 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, bloodsoaked_counter(3), battle_potion_of_intellect
3:28.635 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), bloodsoaked_counter(5), battle_potion_of_intellect
3:29.500 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(7), battle_potion_of_intellect
3:30.796 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(8)
3:31.814 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(8)
3:32.652 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(8)
3:33.912 default L sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(8)
3:34.900 default O moonfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(8)
3:36.035 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(8)
3:37.000 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(8)
3:38.448 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(8)
3:39.895 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(9)
3:41.032 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(10)
3:41.999 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(10)
3:43.447 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(10)
3:44.894 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(11)
3:45.860 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), bloodsoaked_counter(11)
3:46.826 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(2), bloodsoaked_counter(11)
3:48.064 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(12)
3:49.265 default N sunfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(13)
3:50.433 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(14)
3:51.921 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(15)
3:53.410 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), bloodsoaked_counter(15)
3:54.403 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(25), bloodsoaked_counter(15)
3:55.472 default O moonfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), bloodsoaked_counter(15)
3:56.515 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked_counter(16)
3:57.848 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(22), bloodsoaked_counter(17)
3:58.741 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(21), bloodsoaked_counter(17)
3:59.637 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(20), bloodsoaked_counter(18)
4:00.695 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), overwhelming_power(19), bloodsoaked_counter(20)
4:01.757 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18), bloodsoaked_counter(20)
4:03.114 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(16), bloodsoaked_counter(21)
4:04.480 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(15), bloodsoaked_counter(21)
4:05.396 default G use_items Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(14), bloodsoaked_counter(21)
4:05.396 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(14), bloodsoaked_counter(21), ignition_mages_fuse
4:06.433 default I fury_of_elune Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), overwhelming_power(13), bloodsoaked_counter(21), conch_of_dark_whispers, ignition_mages_fuse
4:07.719 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, overwhelming_power(12), bloodsoaked_counter(21), conch_of_dark_whispers, ignition_mages_fuse
4:08.857 default N sunfire Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(11), bloodsoaked_counter(23), conch_of_dark_whispers, ignition_mages_fuse
4:09.965 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(10), bloodsoaked_counter(26), conch_of_dark_whispers, ignition_mages_fuse(2)
4:11.324 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(8), bloodsoaked_counter(28), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.400 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7), bloodsoaked_counter(28), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.736 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(6), bloodsoaked_counter(31), conch_of_dark_whispers, ignition_mages_fuse(3)
4:15.026 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(4), bloodsoaked_counter(33), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.045 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(3), bloodsoaked_counter(33), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.801 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3), bloodsoaked_counter(34), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.903 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power celestial_alignment, solar_empowerment(3), starlord(3), overwhelming_power(2), bloodsoaked_counter(34), conch_of_dark_whispers, ignition_mages_fuse(4)
4:18.657 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, bloodsoaked_counter(35), conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.495 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(35), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.251 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(39), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.320 default M moonfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.109 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked, ignition_mages_fuse(5)
4:23.224 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked, ignition_mages_fuse(5)
4:23.978 default N sunfire Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked, ignition_mages_fuse(5)
4:24.855 default P lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked, ignition_mages_fuse(5)
4:25.969 default Q solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked
4:26.868 default Q solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked
4:27.767 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar, torrent_of_elements, bloodsoaked
4:28.917 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
4:30.119 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
4:31.608 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter
4:33.096 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter
4:34.266 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter
4:35.232 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter
4:36.681 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(2)
4:37.647 default O moonfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(2)
4:38.782 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(2)
4:40.229 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), bloodsoaked_counter(2)
4:41.366 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(2)
4:42.811 default N sunfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), bloodsoaked_counter(2)
4:43.948 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), bloodsoaked_counter(2)
4:44.913 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(2)
4:46.362 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), bloodsoaked_counter(2)
4:47.329 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), bloodsoaked_counter(2)
4:48.294 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(5), bloodsoaked_counter(2)
4:49.533 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(3)
4:51.064 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), solar_empowerment, starlord, bloodsoaked_counter(3)
4:52.266 default P lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(3)
4:53.755 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), bloodsoaked_counter(3), conch_of_dark_whispers
4:54.749 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), bloodsoaked_counter(3), conch_of_dark_whispers
4:55.743 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), starlord(2), bloodsoaked_counter(4), conch_of_dark_whispers
4:56.912 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), starlord(2), bloodsoaked_counter(4), conch_of_dark_whispers
4:58.080 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), starlord(2), bloodsoaked_counter(4), conch_of_dark_whispers
4:59.247 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(7), conch_of_dark_whispers
5:00.694 default N sunfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), bloodsoaked_counter(7), conch_of_dark_whispers
5:01.831 default O moonfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), bloodsoaked_counter(9), conch_of_dark_whispers
5:02.967 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), bloodsoaked_counter(9), conch_of_dark_whispers
5:03.933 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), starlord(3), bloodsoaked_counter(9), conch_of_dark_whispers
5:05.068 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), starlord(3), bloodsoaked_counter(10), conch_of_dark_whispers
5:06.205 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(8), starlord(3), bloodsoaked_counter(12), conch_of_dark_whispers
5:07.339 default I fury_of_elune Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), bloodsoaked_counter(13), conch_of_dark_whispers
5:08.474 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, bloodsoaked_counter(15), conch_of_dark_whispers
5:09.715 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(17)
5:10.605 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord, bloodsoaked_counter(17)
5:11.651 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(2), bloodsoaked_counter(18)
5:12.515 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), starlord(2), bloodsoaked_counter(18)
5:13.809 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(2), bloodsoaked_counter(20)
5:14.826 default L sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(22)
5:15.813 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(23)
5:17.262 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(25)
5:18.400 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(25)
5:19.847 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(25)
5:21.296 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(27)
5:22.743 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(28)
5:23.878 default O moonfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(29)
5:25.015 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(29)
5:25.983 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(29)
5:27.429 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(30)
5:28.877 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), solar_empowerment(2), torrent_of_elements, bloodsoaked_counter(30)
5:30.116 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, bloodsoaked_counter(30)
5:31.139 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, bloodsoaked_counter(30)
5:32.670 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, overwhelming_power(24), bloodsoaked_counter(30)
5:33.609 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(23), bloodsoaked_counter(31)
5:34.550 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), starlord, torrent_of_elements, overwhelming_power(22), bloodsoaked_counter(32)
5:35.662 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(32)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="blood of the enemy"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

conflict+strife : 40229 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
40228.9 40228.9 38.3 / 0.095% 4741.8 / 11.8% 4869.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.2 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Created with Highcharts 4.2.3Damage per Execute Timeconflict+strife Damage per Execute Timemoonfirestarsurgesunfirefury_of_elunesolar_wrathlunar_strike0k10k20k30k40k50k60k70k80k
Created with Highcharts 4.2.3conflict+strife Damage Sourcesstarsurge: 35.4%lunar_strike: 15.5%streaking_stars: 15.2%solar_wrath: 9.0%sunfire: 8.2%moonfire: 8.1%solar_empowerment: 5.1%fury_of_elune: 2.3%heed_my_call: 0.8%heed_my_call_aoe: 0.3%streaking_stars Damage: 15.2%
Created with Highcharts 4.2.3Time (seconds)Damage per secondconflict+strife Damage per secondmean=40228.9500501001502002503003500k50k100k
Created with Highcharts 4.2.3# Iterationsconflict+strife DPS Distributionmin=36121mean=40228max=44749050100150200250
Created with Highcharts 4.2.3conflict+strife Spent Timelunar_strike: 103.5ssolar_wrath: 93.0sstarsurge: 64.5ssunfire: 18.3smoonfire: 14.1sfury_of_elune: 5.3scelestial_alignment: 1.8s

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
conflict+strife 40229
Fury of Elune 916 2.3% 5.4 60.71sec 51100 51795 Direct 133.5 1739 3471 2058 18.4%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 133.50 143.65 0.00 0.9866 0.2957 274773.93 274773.93 0.00 5749.85 51795.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 108.90 81.57% 1739.19 1457 2083 1740.26 1646 1876 189392 189392 0.00
crit 24.60 18.43% 3470.91 2915 4166 3473.15 3157 3922 85382 85382 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 309 (442) 0.8% (1.1%) 8.3 33.47sec 16103 0 Direct 8.3 9499 19007 11261 18.5%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.25 8.25 0.00 0.00 0.0000 0.0000 92954.92 92954.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 81.46% 9499.47 8921 10288 9498.67 0 10288 63865 63865 0.00
crit 1.53 18.54% 19006.95 17842 20575 14957.06 0 20575 29090 29090 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 133 0.3% 8.3 33.47sec 4841 0 Direct 8.3 4072 8143 4840 18.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.25 8.25 0.00 0.00 0.0000 0.0000 39952.97 39952.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 81.11% 4071.54 3823 4409 4071.58 0 4409 27256 27256 0.00
crit 1.56 18.89% 8142.89 7646 8818 6441.62 0 8818 12697 12697 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6232 15.5% 79.6 3.75sec 23520 18090 Direct 79.6 19798 39574 23519 18.8%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.60 79.60 0.00 0.00 1.3002 0.0000 1872241.69 1872241.69 0.00 18089.64 18089.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.62 81.18% 19798.14 10135 25382 19805.47 19069 20937 1279422 1279422 0.00
crit 14.98 18.82% 39573.91 20270 50765 39590.42 35098 43660 592820 592820 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3271 8.1% 14.1 21.39sec 69715 69527 Direct 14.1 3752 7500 4452 18.7%  
Periodic 224.2 3457 6910 4102 18.7% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.09 14.09 224.21 224.21 1.0027 1.3316 982419.16 982419.16 0.00 3141.88 69527.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.46 81.32% 3751.76 3280 4688 3754.42 3485 4028 42992 42992 0.00
crit 2.63 18.68% 7500.07 6559 9376 7053.41 0 9376 19745 19745 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.3 81.32% 3456.95 2 4365 3458.31 3354 3617 630303 630303 0.00
crit 41.9 18.68% 6910.36 60 8729 6912.46 6431 7344 289379 289379 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 3634 (5679) 9.0% (14.1%) 101.8 2.89sec 16768 18354 Direct 102.3 8999 17991 10676 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.75 102.27 0.00 0.00 0.9136 0.0000 1091875.60 1091875.60 0.00 18354.02 18354.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.18 81.34% 8998.58 7949 11363 9002.72 8717 9396 748514 748514 0.00
crit 19.09 18.66% 17990.51 15898 22725 17997.29 16646 19542 343362 343362 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2045 5.1% 75.9 3.86sec 8092 0 Direct 75.9 8092 0 8092 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.92 75.92 0.00 0.00 0.0000 0.0000 614314.27 614314.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.92 100.00% 8091.65 5962 17044 8095.13 7163 9672 614314 614314 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6250.11
  • base_dd_max:6250.11
  • base_dd_mult:1.00
 
Starsurge 14247 35.4% 62.0 4.88sec 69021 66291 Direct 61.8 58360 116639 69241 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.99 61.79 0.00 0.00 1.0412 0.0000 4278618.80 4278618.80 0.00 66290.98 66290.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.25 81.33% 58360.35 51347 72979 58383.28 56372 61228 2932846 2932846 0.00
crit 11.54 18.67% 116639.06 102695 145959 116686.52 105920 135880 1345773 1345773 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 6129 15.2% 91.1 3.08sec 20103 0 Direct 91.1 16967 33957 20103 18.5%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.08 91.08 0.00 0.00 0.0000 0.0000 1831093.64 1831093.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.27 81.54% 16967.39 16021 18475 16966.93 16351 17970 1260194 1260194 0.00
crit 16.81 18.46% 33957.32 32042 36951 33954.96 32444 36163 570900 570900 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3313 8.2% 17.9 16.71sec 55505 54514 Direct 17.9 4688 9368 5568 18.8%  
Periodic 223.5 3376 6752 4006 18.7% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.93 17.93 223.49 223.49 1.0182 1.3320 995209.04 995209.04 0.00 3149.97 54514.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.56 81.19% 4687.75 4112 5878 4688.79 4400 5034 68238 68238 0.00
crit 3.37 18.81% 9368.12 8225 11757 9110.98 0 11757 31602 31602 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.8 81.34% 3376.31 13 4262 3377.71 3284 3520 613734 613734 0.00
crit 41.7 18.66% 6751.61 34 8524 6754.17 6342 7248 281636 281636 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
conflict+strife
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:conflict+strife
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.33sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.12sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9073 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:conflict+strife
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:conflict+strife
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.5 43.9sec 4.9sec 92.61% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:12.24%
  • arcanic_pulsar_2:10.25%
  • arcanic_pulsar_3:11.11%
  • arcanic_pulsar_4:10.62%
  • arcanic_pulsar_5:13.00%
  • arcanic_pulsar_6:11.56%
  • arcanic_pulsar_7:11.17%
  • arcanic_pulsar_8:12.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.6sec 0.0sec 16.17% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.09% 7.52% 0.0(0.0) 2.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.48% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.9sec 37.9sec 25.96% 35.88% 0.0(0.0) 8.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 60.8sec 45.6sec 23.61% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.4 0.0 60.7sec 60.7sec 14.15% 0.00% 84.9(84.9) 5.2

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.23% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 40.9 41.5 7.4sec 3.7sec 77.79% 99.76% 1.8(1.8) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:38.69%
  • lunar_empowerment_2:26.05%
  • lunar_empowerment_3:13.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.3sec 33.7sec 48.14% 0.00% 3.5(48.8) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.83%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.24%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.45%
  • overwhelming_power_22:2.52%
  • overwhelming_power_23:2.60%
  • overwhelming_power_24:2.67%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 29.4 48.6 10.3sec 3.9sec 82.39% 74.36% 0.1(0.1) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:33.64%
  • solar_empowerment_2:35.87%
  • solar_empowerment_3:12.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.7 20.3sec 4.9sec 97.65% 92.85% 16.6(16.6) 12.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.74%
  • starlord_2:22.31%
  • starlord_3:59.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Strife 2.0 52.7 112.0sec 5.4sec 97.82% 0.00% 40.3(40.3) 1.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_strife
  • max_stacks:8
  • duration:14.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:53.82

Stack Uptimes

  • strife_1:3.61%
  • strife_2:3.54%
  • strife_3:3.39%
  • strife_4:3.28%
  • strife_5:3.24%
  • strife_6:3.09%
  • strife_7:3.00%
  • strife_8:74.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:304056
  • name:Strife
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc304081=Your spells and abilities have a chance to increase your Versatility by {$s1=0} for {$304056d=8 seconds}, stacking up to {$304056u=5} times. Being the vicitim of a loss of control or movement impairing effect also grants a stack of Strife.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 61.1sec 45.8sec 23.61% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.61%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
conflict+strife
starsurge Astral Power 62.0 2479.6 40.0 40.0 1725.5
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 102.76 821.68 (33.65%) 8.00 0.38 0.05%
celestial_alignment Astral Power 2.00 80.00 (3.28%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.94 212.34 (8.69%) 2.50 0.00 0.00%
sunfire Astral Power 17.93 53.79 (2.20%) 3.00 0.00 0.00%
moonfire Astral Power 14.09 42.28 (1.73%) 3.00 0.00 0.00%
lunar_strike Astral Power 79.60 954.91 (39.10%) 12.00 0.33 0.03%
natures_balance Astral Power 401.52 200.75 (8.22%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.37 76.44 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.12 8.24
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.01 0.00 72.00
Combo Points 0.00 0.00 0.00
Created with Highcharts 4.2.3conflict+strife Astral Power Gainslunar_strike: 954.9solar_wrath: 821.7fury_of_elune: 212.3natures_balance: 200.8celestial_alignment: 80.0arcanic_pulsar: 76.4sunfire: 53.8moonfire: 42.3
Created with Highcharts 4.2.3Time (seconds)Average Healthconflict+strife Healthmean=323855.1950501001502002503003500k200k400k
Created with Highcharts 4.2.3Time (seconds)Average Manaconflict+strife Manamean=19944.2790501001502002503003500k10k20k30k
Created with Highcharts 4.2.3Time (seconds)Average Energyconflict+strife Energymean=99.721050100150200250300350050100150
Created with Highcharts 4.2.3Time (seconds)Average Astral Powerconflict+strife Astral Powermean=31.726050100150200250300350050100

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data conflict+strife Fight Length
Count 3985
Mean 300.77
Minimum 240.06
Maximum 359.83
Spread ( max - min ) 119.77
Range [ ( max - min ) / 2 * 100% ] 19.91%
DPS
Sample Data conflict+strife Damage Per Second
Count 3985
Mean 40228.95
Minimum 36121.26
Maximum 44749.10
Spread ( max - min ) 8627.83
Range [ ( max - min ) / 2 * 100% ] 10.72%
Standard Deviation 1232.3458
5th Percentile 38295.97
95th Percentile 42317.92
( 95th Percentile - 5th Percentile ) 4021.95
Mean Distribution
Standard Deviation 19.5217
95.00% Confidence Intervall ( 40190.69 - 40267.21 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3605
0.1 Scale Factor Error with Delta=300 12965
0.05 Scale Factor Error with Delta=300 51858
0.01 Scale Factor Error with Delta=300 1296430
Priority Target DPS
Sample Data conflict+strife Priority Target Damage Per Second
Count 3985
Mean 40228.95
Minimum 36121.26
Maximum 44749.10
Spread ( max - min ) 8627.83
Range [ ( max - min ) / 2 * 100% ] 10.72%
Standard Deviation 1232.3458
5th Percentile 38295.97
95th Percentile 42317.92
( 95th Percentile - 5th Percentile ) 4021.95
Mean Distribution
Standard Deviation 19.5217
95.00% Confidence Intervall ( 40190.69 - 40267.21 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3605
0.1 Scale Factor Error with Delta=300 12965
0.05 Scale Factor Error with Delta=300 51858
0.01 Scale Factor Error with Delta=300 1296430
DPS(e)
Sample Data conflict+strife Damage Per Second (Effective)
Count 3985
Mean 40228.95
Minimum 36121.26
Maximum 44749.10
Spread ( max - min ) 8627.83
Range [ ( max - min ) / 2 * 100% ] 10.72%
Damage
Sample Data conflict+strife Damage
Count 3985
Mean 12073454.02
Minimum 9412511.26
Maximum 14947357.17
Spread ( max - min ) 5534845.91
Range [ ( max - min ) / 2 * 100% ] 22.92%
DTPS
Sample Data conflict+strife Damage Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data conflict+strife Healing Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data conflict+strife Healing Per Second (Effective)
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data conflict+strife Heal
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data conflict+strife Healing Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data conflict+strife Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data conflict+strifeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data conflict+strife Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.38 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.33 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.99 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.01 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.87 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.78 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.22 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 79.95 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 102.02 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.14 sunfire

Sample Sequence

012345678ACDKONPHFGIKQKQPKQPQKQPNQPOQPJKQKQPKLPPQPQQQPKQKQPQPQMJKKPNQPKQPPQKQPQQQQKNOKIPPKQPQQQQQJKNKQPKMPQPKQPPQQPNKKPPQQKOPQQKPQNQQKPQQQKGIQPKQMPKNPPPQKPKPQQKPQQQKONPQQQQQKPQKPQPKNQPKQMPQQPKPQKPNPQQHEFIKOKQPQPQKQKQPKNQPQPQQQQKOQPQJKLKPPQKQPKQPQPQOPNKQKQGPQPKQPIQPKQNPOPKQPKQPQKQPKQPKNQPPQOKPPKQPQQKPNQQQQPQKOPKQPKQPINKPQQQQQKKOPPKQPQQKPQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask conflict+strife 58.0/100: 58% astral_power
Pre precombat 1 food conflict+strife 58.0/100: 58% astral_power
Pre precombat 2 augmentation conflict+strife 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.238 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.163 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, strife, battle_potion_of_intellect
0:03.091 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, strife, battle_potion_of_intellect
0:04.268 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, strife, battle_potion_of_intellect
0:05.076 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, strife, battle_potion_of_intellect
0:05.076 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, strife, battle_potion_of_intellect
0:05.076 default I fury_of_elune Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, strife, battle_potion_of_intellect, ignition_mages_fuse
0:05.830 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment(2), starlord, strife, battle_potion_of_intellect, ignition_mages_fuse
0:06.583 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), strife, battle_potion_of_intellect, ignition_mages_fuse
0:07.338 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), strife, battle_potion_of_intellect, ignition_mages_fuse
0:08.092 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), strife, battle_potion_of_intellect, ignition_mages_fuse
0:08.846 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), strife, battle_potion_of_intellect, ignition_mages_fuse
0:09.689 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), strife(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.442 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), strife(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.197 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), strife(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.007 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), strife(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.762 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), strife(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.517 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), strife(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.271 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), strife(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.051 default N sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), strife(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.805 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), strife(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.560 default P lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), strife(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.341 default O moonfire Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.095 default Q solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.848 default P lunar_strike Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.614 default J cancel_buff Fluffy_Pillow 99.0/100: 99% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(23), strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.614 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, solar_empowerment, overwhelming_power(23), strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.370 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(22), strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.126 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(21), strife(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.880 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), strife(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.635 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(20), strife(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.405 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(19), strife(4), ignition_mages_fuse(5)
0:24.161 default L sunfire Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), strife(4), ignition_mages_fuse(5)
0:24.916 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), strife(4), ignition_mages_fuse(5)
0:25.781 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), strife(4)
0:26.829 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(16), strife(4)
0:27.583 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15), strife(4)
0:28.639 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(14), strife(4)
0:29.394 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(13), strife(4)
0:30.229 default Q solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(12)
0:31.066 default P lunar_strike Fluffy_Pillow 85.5/100: 86% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(11), strife
0:32.137 default K starsurge Fluffy_Pillow 98.0/100: 98% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(10), strife
0:32.981 default Q solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(10), strife
0:33.734 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), strife
0:34.489 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), strife(2)
0:35.243 default P lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), strife(2)
0:36.187 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), strife(2)
0:36.941 default P lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), strife(3)
0:37.890 default Q solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5), strife(3)
0:38.645 default M moonfire Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), strife(3)
0:39.399 default J cancel_buff Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), strife(3)
0:39.399 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, torrent_of_elements, overwhelming_power(3), strife(3)
0:40.341 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(2), strife(4)
0:41.261 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power, strife(4)
0:42.744 default N sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, strife(4)
0:43.913 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, strife(5)
0:44.905 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, strife(5)
0:46.393 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, strife(6)
0:47.562 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, strife(6)
0:48.528 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, strife(6)
0:49.974 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), strife(7)
0:51.422 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), strife(7)
0:52.388 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), strife(7)
0:53.523 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), strife(7)
0:54.489 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
0:55.936 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), strife(8)
0:56.901 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), strife(8)
0:57.869 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(5), starlord(3), strife(8)
0:59.007 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(5), starlord(3), strife(8)
1:00.143 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(5), strife(8)
1:01.382 default N sunfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, strife(8)
1:02.583 default O moonfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, strife(8)
1:03.786 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, strife(8)
1:04.988 default I fury_of_elune Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), strife(8)
1:06.244 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), strife(8)
1:07.609 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23), strife(8)
1:08.980 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), overwhelming_power(22), strife(8)
1:10.061 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20), strife(8)
1:10.960 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), strife(8)
1:12.307 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(18), strife(8)
1:13.212 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(17), strife(8)
1:14.120 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(16), strife(8)
1:15.192 default Q solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15), strife(8)
1:16.269 default Q solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(14), strife(8)
1:17.348 default J cancel_buff Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(13), strife(8)
1:17.348 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(8), lunar_empowerment, overwhelming_power(13), strife(8)
1:18.530 default N sunfire Fluffy_Pillow 69.0/100: 69% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(12), strife(8)
1:19.532 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(11), strife(8)
1:20.538 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(10), strife(8)
1:21.370 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(9), strife(8)
1:22.622 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(8), strife(8)
1:23.610 default M moonfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(7), strife(8)
1:24.572 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(6), strife(8)
1:25.989 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(5), strife(8)
1:26.938 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4), strife(8)
1:28.364 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2), strife(8)
1:29.492 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power, strife(8)
1:30.454 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, strife(8)
1:31.902 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, strife(8)
1:33.349 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, strife(8)
1:34.316 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, strife(8)
1:35.282 default P lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), torrent_of_elements, strife(8)
1:36.728 default N sunfire Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, strife(8)
1:37.865 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(3), torrent_of_elements, strife(8)
1:39.102 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, strife(8)
1:40.306 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, strife(8)
1:41.797 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, strife(8)
1:43.285 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, strife(8)
1:44.279 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), torrent_of_elements, strife(8)
1:45.271 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), starlord(2), torrent_of_elements, strife(8)
1:46.439 default O moonfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, strife(8)
1:47.575 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, strife(8)
1:49.024 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, strife(8)
1:49.990 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, strife(8)
1:50.956 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, strife(8)
1:52.091 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, strife(8)
1:53.538 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, strife(8)
1:54.505 default N sunfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, strife(8)
1:55.640 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, strife(8)
1:56.774 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
1:57.910 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), torrent_of_elements, conch_of_dark_whispers, strife(8)
1:59.148 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, strife(8)
2:00.680 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, strife(8)
2:01.702 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), starlord, torrent_of_elements, conch_of_dark_whispers, strife(8)
2:02.905 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), starlord, torrent_of_elements, conch_of_dark_whispers, strife(8)
2:04.109 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), lunar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, strife(8)
2:05.312 default G use_items Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:05.312 default I fury_of_elune Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8), ignition_mages_fuse
2:06.286 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8), ignition_mages_fuse
2:07.111 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8), ignition_mages_fuse
2:08.351 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers, strife(8), ignition_mages_fuse
2:09.248 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers, strife(8), ignition_mages_fuse
2:10.005 default M moonfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers, strife(8), ignition_mages_fuse(2)
2:10.849 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers, strife(8), ignition_mages_fuse(2)
2:12.085 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), starlord(3), overwhelming_power(20), strife(8), ignition_mages_fuse(2)
2:13.063 default N sunfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), strife(8), ignition_mages_fuse(2)
2:14.045 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18), strife(8), ignition_mages_fuse(3)
2:15.252 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), strife(8), ignition_mages_fuse(3)
2:16.439 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), strife(8), ignition_mages_fuse(3)
2:17.627 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(22), strife(8), ignition_mages_fuse(4)
2:18.397 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(2), overwhelming_power(21), strife(8), ignition_mages_fuse(4)
2:19.382 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20), strife(8), ignition_mages_fuse(4)
2:20.605 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), solar_empowerment, starlord, overwhelming_power(24), strife(8), ignition_mages_fuse(4)
2:21.555 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23), strife(8), ignition_mages_fuse(5)
2:22.693 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2), overwhelming_power(22), strife(8), ignition_mages_fuse(5)
2:23.457 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(21), strife(8), ignition_mages_fuse(5)
2:24.222 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(20), strife(8), ignition_mages_fuse(5)
2:25.124 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), strife(8), ignition_mages_fuse(5)
2:26.246 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(18), strife(8)
2:27.152 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(17), strife(8)
2:28.061 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(16), strife(8)
2:28.974 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(16), strife(8)
2:30.047 default O moonfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), strife(8)
2:31.127 default N sunfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), conch_of_dark_whispers, strife(8)
2:32.210 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers, strife(8)
2:33.596 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(11), conch_of_dark_whispers, strife(8)
2:34.523 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(10), conch_of_dark_whispers, strife(8)
2:35.618 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(9), conch_of_dark_whispers, strife(8)
2:36.718 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(8), conch_of_dark_whispers, strife(8)
2:37.822 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(7), conch_of_dark_whispers, strife(8)
2:38.929 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(6), overwhelming_power(6), conch_of_dark_whispers, strife(8)
2:40.140 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(4), conch_of_dark_whispers, strife(8)
2:41.649 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), solar_empowerment, starlord, overwhelming_power(3), conch_of_dark_whispers, strife(8)
2:42.661 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), starlord, overwhelming_power(2), conch_of_dark_whispers, strife(8)
2:43.853 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power, conch_of_dark_whispers, strife(8)
2:45.337 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), conch_of_dark_whispers, strife(8)
2:46.331 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(2), conch_of_dark_whispers, strife(8)
2:47.820 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), starlord(2), conch_of_dark_whispers, strife(8)
2:48.988 default N sunfire Fluffy_Pillow 16.5/100: 17% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
2:49.978 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
2:50.818 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
2:52.078 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power celestial_alignment, solar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
2:53.066 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
2:53.907 default M moonfire Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
2:54.895 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
2:56.343 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
2:57.310 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, starlord(3), conch_of_dark_whispers, strife(8)
2:58.447 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
2:59.894 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, conch_of_dark_whispers, strife(8)
3:01.132 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, strife(8)
3:02.662 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), solar_empowerment, starlord, conch_of_dark_whispers, strife(8)
3:03.684 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment, starlord, strife(8)
3:04.887 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(2), strife(8)
3:06.373 default N sunfire Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(2), strife(8)
3:07.541 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(2), strife(8)
3:09.032 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), strife(8)
3:10.022 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), strife(8)
3:11.016 default H celestial_alignment Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(3), celestial_alignment, starlord(2), strife(8)
3:12.030 default E potion Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(3), celestial_alignment, starlord(2), strife(8)
3:12.030 default F berserking Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(3), celestial_alignment, starlord(2), strife(8), battle_potion_of_intellect
3:12.030 default I fury_of_elune Fluffy_Pillow 89.0/100: 89% astral_power berserking, arcanic_pulsar(3), celestial_alignment, starlord(2), strife(8), battle_potion_of_intellect
3:12.956 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, starlord(2), strife(8), battle_potion_of_intellect
3:13.878 default O moonfire Fluffy_Pillow 57.5/100: 57% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), strife(8), battle_potion_of_intellect
3:14.780 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), strife(8), battle_potion_of_intellect
3:15.679 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), strife(8), battle_potion_of_intellect
3:16.443 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), strife(8), battle_potion_of_intellect
3:17.587 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), strife(8), battle_potion_of_intellect
3:18.351 default P lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), strife(8), battle_potion_of_intellect
3:19.495 default Q solar_wrath Fluffy_Pillow 91.5/100: 92% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, starlord(3), strife(8), battle_potion_of_intellect
3:20.394 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power berserking, arcanic_pulsar(5), celestial_alignment, strife(8), battle_potion_of_intellect
3:21.374 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, strife(8), battle_potion_of_intellect
3:22.181 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord, strife(8), battle_potion_of_intellect
3:23.133 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), strife(8), battle_potion_of_intellect
3:23.920 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), strife(8), battle_potion_of_intellect
3:25.098 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(2), strife(8), battle_potion_of_intellect
3:26.116 default N sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), strife(8), battle_potion_of_intellect
3:27.103 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), strife(8), battle_potion_of_intellect
3:27.874 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), strife(8), battle_potion_of_intellect
3:29.030 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(22), strife(8), battle_potion_of_intellect
3:29.943 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(22), strife(8), battle_potion_of_intellect
3:31.105 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(20), strife(8), battle_potion_of_intellect
3:32.162 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(19), strife(8), battle_potion_of_intellect
3:33.224 default Q solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(18), strife(8), battle_potion_of_intellect
3:34.289 default Q solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(25), strife(8), battle_potion_of_intellect
3:35.327 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(24), strife(8), battle_potion_of_intellect
3:36.369 default O moonfire Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), strife(8), battle_potion_of_intellect
3:37.279 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), strife(8)
3:38.055 default P lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(21), strife(8)
3:39.223 default Q solar_wrath Fluffy_Pillow 90.5/100: 91% astral_power celestial_alignment, starlord(3), overwhelming_power(20), strife(8)
3:40.142 default J cancel_buff Fluffy_Pillow 99.0/100: 99% astral_power celestial_alignment, starlord(3), overwhelming_power(19), conch_of_dark_whispers, strife(8)
3:40.142 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power celestial_alignment, overwhelming_power(19), conch_of_dark_whispers, strife(8)
3:41.147 default L sunfire Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18), conch_of_dark_whispers, strife(8)
3:42.129 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17), conch_of_dark_whispers, strife(8)
3:43.260 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16), conch_of_dark_whispers, strife(8)
3:44.664 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15), conch_of_dark_whispers, strife(8)
3:46.074 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(2), overwhelming_power(13), conch_of_dark_whispers, strife(8)
3:47.022 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(2), overwhelming_power(12), conch_of_dark_whispers, strife(8)
3:48.141 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(11), conch_of_dark_whispers, strife(8)
3:49.067 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers, strife(8)
3:50.463 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers, strife(8)
3:51.562 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(8), conch_of_dark_whispers, strife(8)
3:52.500 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers, strife(8)
3:53.912 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(6), conch_of_dark_whispers, strife(8)
3:54.855 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), conch_of_dark_whispers, strife(8)
3:56.276 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), overwhelming_power(3), strife(8)
3:57.231 default O moonfire Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2), strife(8)
3:58.357 default P lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, strife(8)
3:59.798 default N sunfire Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), strife(8)
4:00.936 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(4), solar_empowerment(2), strife(8)
4:02.175 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, strife(8)
4:03.196 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, strife(8)
4:04.401 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), strife(8)
4:05.395 default G use_items Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), strife(8)
4:05.395 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), strife(8), ignition_mages_fuse
4:06.819 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), strife(8), ignition_mages_fuse
4:07.770 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), strife(8), ignition_mages_fuse
4:09.196 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), strife(8), ignition_mages_fuse
4:10.317 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), strife(8), ignition_mages_fuse(2)
4:11.206 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), strife(8), ignition_mages_fuse(2)
4:12.536 default I fury_of_elune Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), strife(8), ignition_mages_fuse(2)
4:13.579 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), strife(8), ignition_mages_fuse(3)
4:14.434 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), strife(8), ignition_mages_fuse(3)
4:15.619 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), strife(8), ignition_mages_fuse(3)
4:16.552 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22), strife(8), ignition_mages_fuse(3)
4:17.347 default N sunfire Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), strife(8), ignition_mages_fuse(3)
4:18.287 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), strife(8), ignition_mages_fuse(4)
4:19.445 default O moonfire Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), strife(8), ignition_mages_fuse(4)
4:20.358 default P lunar_strike Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), strife(8), ignition_mages_fuse(4)
4:21.521 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), solar_empowerment(2), torrent_of_elements, overwhelming_power(17), strife(8), ignition_mages_fuse(5)
4:22.485 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(16), strife(8), ignition_mages_fuse(5)
4:23.241 default P lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(15), strife(8), ignition_mages_fuse(5)
4:24.284 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(14), strife(8), ignition_mages_fuse(5)
4:25.105 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(13), strife(8), ignition_mages_fuse(5)
4:25.860 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(13), strife(8)
4:27.095 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(11), strife(8)
4:27.925 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(11), strife(8)
4:28.900 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(10), strife(8)
4:29.830 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), strife(8)
4:31.231 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), strife(8)
4:32.338 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(25), strife(8)
4:33.221 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), strife(8)
4:34.551 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), strife(8)
4:35.597 default N sunfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(22), strife(8)
4:36.648 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(21), strife(8)
4:37.542 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), strife(8)
4:38.889 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), strife(8)
4:40.239 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), strife(8)
4:41.146 default O moonfire Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), strife(8)
4:42.218 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, torrent_of_elements, overwhelming_power(15), strife(8)
4:43.391 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(14), strife(8)
4:44.846 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(13), strife(8)
4:46.307 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, overwhelming_power(11), strife(8)
4:47.460 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(10), strife(8)
4:48.416 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9), strife(8)
4:49.855 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(8), strife(8)
4:50.819 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(7), strife(8)
4:51.785 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), starlord(2), overwhelming_power(6), strife(8)
4:52.928 default P lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5), strife(8)
4:54.350 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(3), strife(8)
4:55.473 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(2), strife(8)
4:56.433 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power, strife(8)
4:57.566 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), starlord(3), strife(8)
4:58.705 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), starlord(3), strife(8)
4:59.842 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), strife(8)
5:01.290 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(7), starlord(3), strife(8)
5:02.427 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(7), strife(8)
5:03.665 default O moonfire Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, strife(8)
5:04.867 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, strife(8)
5:06.400 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), solar_empowerment, starlord, conch_of_dark_whispers, strife(8)
5:07.603 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, strife(8)
5:08.468 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers, strife(8)
5:09.762 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, solar_empowerment, starlord(2), conch_of_dark_whispers, strife(8)
5:10.778 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
5:11.618 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
5:12.877 default I fury_of_elune Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
5:13.865 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
5:15.001 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
5:16.138 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
5:17.586 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), fury_of_elune, solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
5:18.553 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), fury_of_elune, solar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
5:19.520 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(2), fury_of_elune, starlord(3), conch_of_dark_whispers, strife(8)
5:20.656 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(2), fury_of_elune, starlord(3), conch_of_dark_whispers, strife(8)
5:21.793 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(2), starlord(3), conch_of_dark_whispers, strife(8)
5:22.930 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(2), conch_of_dark_whispers, strife(8)
5:24.169 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, strife(8)
5:25.370 default O moonfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, strife(8)
5:26.539 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, strife(8)
5:28.026 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), strife(8)
5:29.388 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(24), strife(8)
5:30.461 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), strife(8)
5:31.347 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), strife(8)
5:32.687 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(21), strife(8)
5:33.581 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(20), strife(8)
5:34.482 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(19), strife(8)
5:35.546 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), strife(8)
5:36.901 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(17), strife(8)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="conflict+strife"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

crucible of flame : 40237 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
40237.2 40237.2 38.7 / 0.096% 4776.2 / 11.9% 4871.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.2 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
crucible of flame 40237
Ancient Flame 1537 3.8% 25.2 11.67sec 18349 0 Periodic 90.8 4284 8605 5089 18.6% 58.3%

Stats details: ancient_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.19 0.00 90.81 90.81 0.0000 1.9313 462210.09 462210.09 0.00 2635.40 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.9 81.36% 4283.53 2 7761 4256.70 2592 5974 316501 316501 0.00
crit 16.9 18.64% 8605.39 5 15522 8545.39 4481 13700 145709 145709 0.00
 
 

Action details: ancient_flame

Static Values
  • id:295367
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295367
  • name:Ancient Flame
  • school:fire
  • tooltip:Suffering $w1 fire damage every $t1 sec.
  • description:{$@spelldesc295365=Your spells and abilities have a chance to cauterize your target for ${$m3*5} Fire damage over {$295367d=10 seconds} or healing an ally for ${$m3*5} over {$295367d=10 seconds}$?a295369[, stacking up to {$295367u=1} times][].}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1582.83
  • base_td_mult:1.35
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fury of Elune 887 2.2% 5.4 60.74sec 49443 50092 Direct 133.4 1681 3356 1992 18.6%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 133.43 143.58 0.00 0.9871 0.2959 265836.41 265836.41 0.00 5562.83 50091.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 108.60 81.39% 1680.56 1457 1987 1681.78 1590 1826 182504 182504 0.00
crit 24.83 18.61% 3356.44 2915 3974 3359.04 3061 3770 83332 83332 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 297 (425) 0.7% (1.1%) 8.3 33.35sec 15475 0 Direct 8.3 9126 18284 10833 18.6%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.26 8.26 0.00 0.00 0.0000 0.0000 89449.09 89449.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 81.35% 9125.91 8921 9813 9126.02 8921 9813 61301 61301 0.00
crit 1.54 18.65% 18283.59 17842 19626 14552.30 0 19626 28148 28148 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 127 0.3% 8.3 33.35sec 4641 0 Direct 8.3 3913 7822 4641 18.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.26 8.26 0.00 0.00 0.0000 0.0000 38321.70 38321.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 81.36% 3912.68 3823 4206 3911.31 0 4206 26285 26285 0.00
crit 1.54 18.64% 7822.06 7646 8411 6175.12 0 8411 12036 12036 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5985 14.9% 79.6 3.74sec 22581 17367 Direct 79.6 19018 38046 22582 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.63 79.63 0.00 0.00 1.3002 0.0000 1798180.76 1798180.76 0.00 17366.85 17366.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.72 81.28% 19018.46 10135 24211 19026.29 18382 19925 1230968 1230968 0.00
crit 14.91 18.72% 38046.02 20270 48422 38060.14 34492 42518 567213 567213 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3144 7.8% 14.1 21.42sec 66985 66786 Direct 14.1 3611 7211 4267 18.2%  
Periodic 224.2 3324 6647 3944 18.6% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.10 14.10 224.19 224.19 1.0030 1.3317 944283.36 944283.36 0.00 3019.80 66785.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.53 81.79% 3611.47 3280 4472 3614.12 3342 4005 41639 41639 0.00
crit 2.57 18.21% 7211.43 6559 8943 6757.42 0 8943 18512 18512 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.4 81.35% 3324.09 4 4163 3325.58 3229 3459 606267 606267 0.00
crit 41.8 18.65% 6646.83 16 8327 6649.77 6276 7150 277865 277865 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 3491 (5455) 8.7% (13.6%) 101.7 2.89sec 16121 17646 Direct 102.2 8651 17282 10265 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.67 102.18 0.00 0.00 0.9136 0.0000 1048830.54 1048830.54 0.00 17646.30 17646.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.08 81.31% 8651.34 7949 10838 8655.62 8399 9044 718787 718787 0.00
crit 19.10 18.69% 17282.38 15898 21676 17291.16 15898 19039 330044 330044 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1964 4.9% 75.9 3.86sec 7780 0 Direct 75.9 7780 0 7780 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.86 75.86 0.00 0.00 0.0000 0.0000 590210.91 590210.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.86 100.00% 7780.39 5962 16257 7783.91 6729 9063 590211 590211 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 13699 34.1% 62.0 4.88sec 66370 63730 Direct 61.8 56129 112228 66580 18.6%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.98 61.78 0.00 0.00 1.0414 0.0000 4113523.50 4113523.50 0.00 63730.11 63730.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.27 81.37% 56129.42 51347 69612 56156.22 54101 59177 2821684 2821684 0.00
crit 11.51 18.63% 112228.31 102695 139223 112282.83 102695 135005 1291839 1291839 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 5922 14.6% 91.1 3.08sec 19428 0 Direct 91.1 16386 32781 19428 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.06 91.06 0.00 0.00 0.0000 0.0000 1769190.80 1769190.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.17 81.44% 16385.78 16021 17623 16385.74 16021 17236 1215265 1215265 0.00
crit 16.90 18.56% 32780.87 32042 35246 32780.48 32042 34979 553926 553926 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3184 7.9% 17.9 16.75sec 53377 52413 Direct 17.9 4509 9019 5348 18.6%  
Periodic 223.5 3247 6486 3851 18.6% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.92 17.92 223.49 223.49 1.0184 1.3321 956484.59 956484.59 0.00 3027.26 52412.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.59 81.40% 4508.65 4112 5607 4509.70 4171 4851 65762 65762 0.00
crit 3.33 18.60% 9018.90 8225 11214 8742.87 0 11214 30066 30066 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.8 81.35% 3246.95 7 4065 3248.42 3166 3382 590321 590321 0.00
crit 41.7 18.65% 6486.40 73 8130 6488.87 6084 6974 270334 270334 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
crucible of flame
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.46sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.25sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9061 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.5 43.9sec 4.9sec 92.63% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:12.24%
  • arcanic_pulsar_2:10.24%
  • arcanic_pulsar_3:11.09%
  • arcanic_pulsar_4:10.64%
  • arcanic_pulsar_5:13.02%
  • arcanic_pulsar_6:11.55%
  • arcanic_pulsar_7:11.18%
  • arcanic_pulsar_8:12.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.6sec 0.0sec 16.17% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.09% 7.57% 0.0(0.0) 2.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.48% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.9sec 37.9sec 25.96% 35.89% 0.0(0.0) 8.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.3sec 23.68% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.4 0.0 60.7sec 60.7sec 14.14% 0.00% 84.9(84.9) 5.2

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.24% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 40.9 41.6 7.4sec 3.6sec 77.79% 99.77% 1.8(1.8) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:38.70%
  • lunar_empowerment_2:26.00%
  • lunar_empowerment_3:13.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.6sec 33.9sec 47.87% 0.00% 3.5(48.6) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.22%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.51%
  • overwhelming_power_23:2.58%
  • overwhelming_power_24:2.66%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 29.4 48.6 10.3sec 3.9sec 82.44% 74.35% 0.1(0.1) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:33.69%
  • solar_empowerment_2:35.95%
  • solar_empowerment_3:12.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.7 20.3sec 4.9sec 97.64% 92.84% 16.5(16.5) 12.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.70%
  • starlord_2:22.28%
  • starlord_3:59.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.3sec 45.7sec 23.62% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
crucible of flame
starsurge Astral Power 62.0 2479.1 40.0 40.0 1659.2
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 102.67 820.96 (33.62%) 8.00 0.38 0.05%
celestial_alignment Astral Power 2.00 80.00 (3.28%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.93 212.33 (8.70%) 2.50 0.00 0.00%
sunfire Astral Power 17.92 53.76 (2.20%) 3.00 0.00 0.00%
moonfire Astral Power 14.10 42.29 (1.73%) 3.00 0.00 0.00%
lunar_strike Astral Power 79.64 955.27 (39.12%) 12.00 0.36 0.04%
natures_balance Astral Power 401.52 200.75 (8.22%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.37 76.40 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.12 8.24
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.73 0.00 60.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data crucible of flame Fight Length
Count 3985
Mean 300.77
Minimum 240.06
Maximum 359.83
Spread ( max - min ) 119.77
Range [ ( max - min ) / 2 * 100% ] 19.91%
DPS
Sample Data crucible of flame Damage Per Second
Count 3985
Mean 40237.19
Minimum 36314.74
Maximum 45138.44
Spread ( max - min ) 8823.70
Range [ ( max - min ) / 2 * 100% ] 10.96%
Standard Deviation 1248.0584
5th Percentile 38275.76
95th Percentile 42322.57
( 95th Percentile - 5th Percentile ) 4046.82
Mean Distribution
Standard Deviation 19.7706
95.00% Confidence Intervall ( 40198.44 - 40275.94 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3696
0.1 Scale Factor Error with Delta=300 13297
0.05 Scale Factor Error with Delta=300 53188
0.01 Scale Factor Error with Delta=300 1329700
Priority Target DPS
Sample Data crucible of flame Priority Target Damage Per Second
Count 3985
Mean 40237.19
Minimum 36314.74
Maximum 45138.44
Spread ( max - min ) 8823.70
Range [ ( max - min ) / 2 * 100% ] 10.96%
Standard Deviation 1248.0584
5th Percentile 38275.76
95th Percentile 42322.57
( 95th Percentile - 5th Percentile ) 4046.82
Mean Distribution
Standard Deviation 19.7706
95.00% Confidence Intervall ( 40198.44 - 40275.94 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3696
0.1 Scale Factor Error with Delta=300 13297
0.05 Scale Factor Error with Delta=300 53188
0.01 Scale Factor Error with Delta=300 1329700
DPS(e)
Sample Data crucible of flame Damage Per Second (Effective)
Count 3985
Mean 40237.19
Minimum 36314.74
Maximum 45138.44
Spread ( max - min ) 8823.70
Range [ ( max - min ) / 2 * 100% ] 10.96%
Damage
Sample Data crucible of flame Damage
Count 3985
Mean 12076521.74
Minimum 9382347.32
Maximum 14785487.53
Spread ( max - min ) 5403140.21
Range [ ( max - min ) / 2 * 100% ] 22.37%
DTPS
Sample Data crucible of flame Damage Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data crucible of flame Healing Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data crucible of flame Healing Per Second (Effective)
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data crucible of flame Heal
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data crucible of flame Healing Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data crucible of flame Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data crucible of flameTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data crucible of flame Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.38 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.32 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.98 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.99 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.87 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.78 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.22 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 80.00 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 101.93 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.15 sunfire

Sample Sequence

012345678ACDKONPHFGIKQKQKQPQKQPQNQPOQPJKQPKQPKPPPQQQQQKNKQPQPQMKPKPPKQPPKNQPPQQQQKKOPIPKNQPPQQQKQPKQKMPPKNQPQKPQPQQQQKPKNOPQPKPQQKPQPQKNQGQIKMPPKPKQPQPPQNKPKQPQOKPQQQKPQNQPKPQQQKQPKQPMPKNQPPKQPQPHEFIQKOQKNQPQKQPQRKQKQPKQPQPKMPPPQNQPKKPPKQPQQKOPNQQQPGKPQKIPQKPQQNQOQQKQPQKQKLPKPPQQKPPOQQQPKNKPPQQKPQPQKPQONQKQPIKQLPKPKPQQQPOQKPKPQQQK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask crucible of flame 58.0/100: 58% astral_power
Pre precombat 1 food crucible of flame 58.0/100: 58% astral_power
Pre precombat 2 augmentation crucible of flame 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.164 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.090 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.268 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.073 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.073 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.073 default I fury_of_elune Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.825 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.576 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.331 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.085 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.839 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.593 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.346 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.156 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.909 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.663 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.417 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.196 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.950 default N sunfire Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.704 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.458 default P lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.238 default O moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.992 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.747 default P lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.571 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.571 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.326 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.081 default P lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.920 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.675 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.431 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
0:24.247 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
0:25.002 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(5)
0:25.914 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
0:27.027 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
0:28.141 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements
0:28.897 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements
0:29.772 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:30.647 default Q solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:31.522 default Q solar_wrath Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
0:32.398 default K starsurge Fluffy_Pillow 99.5/100: 100% astral_power bloodlust, arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
0:33.273 default N sunfire Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
0:34.035 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
0:34.797 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:35.551 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
0:36.520 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
0:37.275 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers
0:38.244 default Q solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers
0:39.004 default M moonfire Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers
0:39.766 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), conch_of_dark_whispers
0:40.720 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord, conch_of_dark_whispers
0:41.897 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(25), conch_of_dark_whispers
0:42.997 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(24), conch_of_dark_whispers
0:44.362 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22), conch_of_dark_whispers
0:45.737 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers
0:46.820 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), conch_of_dark_whispers
0:47.720 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers
0:49.072 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
0:50.432 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers
0:51.506 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15), conch_of_dark_whispers
0:52.585 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14), conch_of_dark_whispers
0:53.502 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers
0:54.881 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers
0:56.266 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
0:57.197 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(9), conch_of_dark_whispers
0:58.131 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(8), conch_of_dark_whispers
0:59.235 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(7), conch_of_dark_whispers
1:00.340 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(5), overwhelming_power(6), conch_of_dark_whispers
1:01.552 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(5), conch_of_dark_whispers
1:02.734 default O moonfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(4), conch_of_dark_whispers
1:03.886 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(3), conch_of_dark_whispers
1:05.358 default I fury_of_elune Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power, conch_of_dark_whispers
1:06.521 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2)
1:08.010 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2)
1:09.180 default N sunfire Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3)
1:10.317 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3)
1:11.284 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:12.731 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3)
1:14.181 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
1:15.147 default Q solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
1:16.113 default Q solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(8), starlord(3)
1:17.248 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(8), starlord(3)
1:18.385 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
1:19.226 default P lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power celestial_alignment, lunar_empowerment, starlord(3)
1:20.484 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power celestial_alignment
1:21.560 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord
1:22.449 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord
1:23.496 default M moonfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
1:24.513 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2)
1:26.001 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23)
1:27.373 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(2), overwhelming_power(22)
1:28.453 default N sunfire Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21)
1:29.507 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(25)
1:30.390 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
1:31.716 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(23)
1:32.605 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(22)
1:33.657 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
1:34.999 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(20)
1:35.900 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19)
1:37.252 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(17)
1:38.161 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(16)
1:39.232 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(15)
1:40.307 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(14)
1:41.388 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(4), overwhelming_power(13)
1:42.572 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12)
1:44.037 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), solar_empowerment, starlord, overwhelming_power(10)
1:45.199 default N sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9)
1:46.328 default O moonfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(8)
1:47.463 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7)
1:48.914 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(6)
1:49.886 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(5)
1:51.347 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(3)
1:52.502 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2)
1:53.940 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), overwhelming_power
1:54.905 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
1:55.873 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
1:57.010 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:58.458 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
1:59.426 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
2:00.872 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
2:01.839 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), conch_of_dark_whispers
2:03.078 default N sunfire Fluffy_Pillow 19.0/100: 19% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
2:04.125 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
2:05.014 default G use_items Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, lunar_empowerment(2), starlord, conch_of_dark_whispers
2:05.014 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, lunar_empowerment(2), starlord, conch_of_dark_whispers, ignition_mages_fuse
2:06.015 default I fury_of_elune Fluffy_Pillow 40.0/100: 40% astral_power celestial_alignment, lunar_empowerment(2), starlord, conch_of_dark_whispers, ignition_mages_fuse
2:07.017 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord, conch_of_dark_whispers, ignition_mages_fuse
2:08.019 default M moonfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse
2:08.991 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse
2:10.416 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.784 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.856 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.187 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.189 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(3)
2:16.041 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
2:17.320 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse(4)
2:18.140 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
2:19.370 default P lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
2:20.599 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
2:21.421 default N sunfire Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), ignition_mages_fuse(5)
2:22.353 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(3), solar_empowerment, ignition_mages_fuse(5)
2:23.368 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, ignition_mages_fuse(5)
2:24.622 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, ignition_mages_fuse(5)
2:25.607 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2)
2:26.600 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
2:28.088 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2)
2:29.080 default O moonfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2)
2:30.248 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2)
2:31.418 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
2:32.865 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3)
2:33.831 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
2:34.798 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
2:35.765 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), starlord(3)
2:36.901 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3)
2:38.350 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
2:39.315 default N sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), conch_of_dark_whispers
2:40.450 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), conch_of_dark_whispers
2:41.415 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), conch_of_dark_whispers
2:42.863 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), torrent_of_elements, conch_of_dark_whispers
2:44.102 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
2:45.632 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
2:46.656 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(8), starlord, torrent_of_elements, conch_of_dark_whispers
2:47.858 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), starlord, torrent_of_elements, conch_of_dark_whispers
2:49.062 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), starlord, torrent_of_elements, conch_of_dark_whispers
2:50.264 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
2:51.055 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
2:52.244 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
2:53.181 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
2:53.958 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
2:55.122 default M moonfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20)
2:56.042 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19)
2:57.392 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(18)
2:58.456 default N sunfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(17)
2:59.524 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(16)
3:00.435 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15)
3:01.807 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
3:03.183 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(2), solar_empowerment(2), overwhelming_power(12)
3:04.369 default Q solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(11)
3:05.352 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(10)
3:06.827 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord, overwhelming_power(9)
3:07.817 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(8)
3:09.304 default H celestial_alignment Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(6)
3:10.327 default E potion Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(5)
3:10.327 default F berserking Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(5), battle_potion_of_intellect
3:10.327 default I fury_of_elune Fluffy_Pillow 84.5/100: 85% astral_power berserking, arcanic_pulsar(3), celestial_alignment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(5), battle_potion_of_intellect
3:11.261 default Q solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(4), battle_potion_of_intellect
3:12.059 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(3), battle_potion_of_intellect
3:13.000 default O moonfire Fluffy_Pillow 65.5/100: 66% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(2), battle_potion_of_intellect
3:13.917 default Q solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(2), battle_potion_of_intellect
3:14.697 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power, battle_potion_of_intellect
3:15.617 default N sunfire Fluffy_Pillow 50.5/100: 51% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:16.517 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:17.282 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:18.428 default Q solar_wrath Fluffy_Pillow 90.5/100: 91% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:19.192 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:20.090 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:20.855 default P lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:22.001 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:22.767 default R sunfire Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:23.756 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:24.833 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:25.724 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:26.767 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:27.635 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:28.929 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:29.946 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:30.786 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:32.046 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:32.888 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:34.146 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:35.135 default M moonfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:36.125 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3)
3:37.571 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3)
3:39.018 default P lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3)
3:40.465 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3)
3:41.431 default N sunfire Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar, solar_empowerment, starlord(3)
3:42.566 default Q solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar, solar_empowerment, starlord(3)
3:43.531 default P lunar_strike Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar, lunar_empowerment, starlord(3)
3:44.980 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power arcanic_pulsar
3:46.220 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord
3:47.425 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
3:48.915 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
3:50.404 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), torrent_of_elements
3:51.572 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
3:52.538 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:53.985 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements
3:54.953 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements
3:55.918 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements
3:57.054 default O moonfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:58.192 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:59.640 default N sunfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements
4:00.775 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements
4:01.741 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
4:02.877 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
4:04.013 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), torrent_of_elements
4:05.459 default G use_items Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(5), torrent_of_elements
4:05.459 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(5), torrent_of_elements, ignition_mages_fuse
4:06.645 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse
4:08.110 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse
4:09.088 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), starlord, torrent_of_elements, ignition_mages_fuse
4:10.240 default I fury_of_elune Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(2)
4:11.400 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(2)
4:12.767 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(2)
4:13.681 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), fury_of_elune, starlord(2), torrent_of_elements, ignition_mages_fuse(3)
4:14.712 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(25), ignition_mages_fuse(3)
4:15.892 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment, starlord(3), overwhelming_power(24), ignition_mages_fuse(3)
4:16.682 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), fury_of_elune, starlord(3), overwhelming_power(23), ignition_mages_fuse(3)
4:17.615 default N sunfire Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(8), fury_of_elune, starlord(3), overwhelming_power(22), ignition_mages_fuse(4)
4:18.519 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(21), ignition_mages_fuse(4)
4:19.423 default O moonfire Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(20), ignition_mages_fuse(4)
4:20.331 default Q solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(19), ignition_mages_fuse(4)
4:21.242 default Q solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(18), ignition_mages_fuse(4)
4:22.155 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(17), ignition_mages_fuse(5)
4:23.042 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(16), ignition_mages_fuse(5)
4:23.797 default P lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(16), ignition_mages_fuse(5)
4:24.780 default Q solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power celestial_alignment, starlord(3), overwhelming_power(15), ignition_mages_fuse(5)
4:25.553 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power celestial_alignment, overwhelming_power(14)
4:26.576 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13)
4:27.426 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, overwhelming_power(12)
4:28.426 default L sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(11)
4:29.403 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(10)
4:30.836 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(9)
4:31.966 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8)
4:33.370 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6)
4:34.786 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(5), conch_of_dark_whispers
4:35.736 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(4), conch_of_dark_whispers
4:36.688 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power(3), conch_of_dark_whispers
4:37.811 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(2), conch_of_dark_whispers
4:39.249 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:40.698 default O moonfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers
4:41.738 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers
4:42.625 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
4:43.515 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(22), conch_of_dark_whispers
4:44.565 default P lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers
4:45.907 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(4), overwhelming_power(20), conch_of_dark_whispers
4:47.061 default N sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18), conch_of_dark_whispers
4:48.187 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17), conch_of_dark_whispers
4:49.316 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16), conch_of_dark_whispers
4:50.720 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15)
4:52.130 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(13)
4:53.079 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(12)
4:54.030 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), starlord(2), overwhelming_power(11)
4:55.153 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(10)
4:56.548 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(9)
4:57.485 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), overwhelming_power(8)
4:58.892 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(7)
5:00.000 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(5)
5:01.117 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(4), conch_of_dark_whispers
5:02.541 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(3), conch_of_dark_whispers
5:03.495 default O moonfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(2), conch_of_dark_whispers
5:04.623 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power, conch_of_dark_whispers
5:05.756 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
5:06.893 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), torrent_of_elements, conch_of_dark_whispers
5:08.131 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
5:09.022 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
5:10.355 default I fury_of_elune Fluffy_Pillow 41.0/100: 41% astral_power celestial_alignment, starlord, torrent_of_elements, conch_of_dark_whispers
5:11.401 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, fury_of_elune, starlord, torrent_of_elements, conch_of_dark_whispers
5:12.447 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
5:13.311 default L sunfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
5:14.326 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
5:15.814 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, fury_of_elune, starlord(2), torrent_of_elements
5:16.984 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
5:18.433 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements
5:19.570 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
5:21.016 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), torrent_of_elements
5:21.981 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
5:22.948 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
5:23.915 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3)
5:25.363 default O moonfire Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(3), starlord(3)
5:26.499 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(3), starlord(3)
5:27.636 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(3)
5:28.876 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
5:30.407 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), solar_empowerment, starlord
5:31.611 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
5:33.098 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2)
5:34.092 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2)
5:35.086 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), starlord(2)
5:36.255 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), starlord(2)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="crucible of flame"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

focusing iris : 40211 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
40211.4 40211.4 36.8 / 0.091% 4530.9 / 11.3% 4705.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.5 8.4 Astral Power 0.00% 60.2 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
focusing iris 40211
Fury of Elune 927 2.3% 5.4 60.80sec 51714 54494 Direct 139.1 1685 3369 1997 18.5%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.37 139.14 150.39 0.00 0.9490 0.2823 277917.72 277917.72 0.00 5843.40 54493.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 113.35 81.47% 1685.48 1457 1987 1686.79 1591 1837 191049 191049 0.00
crit 25.78 18.53% 3369.00 2915 3974 3371.26 3061 3780 86868 86868 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 308 (440) 0.8% (1.1%) 8.5 32.47sec 15487 0 Direct 8.5 9127 18244 10839 18.8%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.55 8.55 0.00 0.00 0.0000 0.0000 92624.77 92624.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.94 81.22% 9127.11 8921 9813 9127.42 8921 9813 63346 63346 0.00
crit 1.60 18.78% 18244.14 17842 19626 14962.92 0 19626 29278 29278 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 132 0.3% 8.5 32.47sec 4648 0 Direct 8.5 3912 7820 4648 18.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.55 8.55 0.00 0.00 0.0000 0.0000 39717.25 39717.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.94 81.16% 3911.53 3823 4206 3911.35 3823 4206 27128 27128 0.00
crit 1.61 18.84% 7819.67 7646 8411 6262.93 0 8411 12590 12590 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6231 15.5% 82.9 3.59sec 22591 18166 Direct 82.9 19049 38104 22590 18.6%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.88 82.88 0.00 0.00 1.2435 0.0000 1872413.99 1872413.99 0.00 18166.25 18166.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.48 81.41% 19049.18 10135 24211 19056.09 18370 19936 1285445 1285445 0.00
crit 15.40 18.59% 38103.86 20270 48422 38115.52 34052 42003 586969 586969 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3274 8.1% 14.2 21.36sec 69210 71056 Direct 14.2 3583 7166 4253 18.7%  
Periodic 233.8 3328 6653 3948 18.6% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.21 14.21 233.81 233.81 0.9741 1.2775 983479.32 983479.32 0.00 3146.72 71055.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.55 81.30% 3583.34 3280 4472 3584.01 3344 3886 41398 41398 0.00
crit 2.66 18.70% 7165.92 6559 8943 6754.09 0 8943 19042 19042 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 190.2 81.36% 3327.97 4 4163 3329.38 3240 3450 633086 633086 0.00
crit 43.6 18.64% 6653.17 75 8327 6655.64 6271 7163 289954 289954 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 3681 (5721) 9.2% (14.2%) 107.2 2.74sec 16030 18074 Direct 107.7 8657 17294 10267 18.6%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.23 107.72 0.00 0.00 0.8869 0.0000 1105927.00 1105927.00 0.00 18074.21 18074.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.64 81.36% 8657.42 7949 10838 8661.78 8400 9083 758745 758745 0.00
crit 20.07 18.64% 17294.34 15898 21676 17304.95 16042 18890 347182 347182 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2040 5.1% 78.7 3.73sec 7793 0 Direct 78.7 7793 0 7793 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.66 78.66 0.00 0.00 0.0000 0.0000 612966.43 612966.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.66 100.00% 7792.62 5962 16257 7796.64 6904 8903 612966 612966 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 14185 35.3% 64.1 4.71sec 66429 66252 Direct 63.9 56214 112303 66634 18.6%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.13 63.94 0.00 0.00 1.0027 0.0000 4260297.14 4260297.14 0.00 66252.44 66252.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.06 81.42% 56214.25 51347 69612 56239.82 54106 58802 2926517 2926517 0.00
crit 11.88 18.58% 112302.62 102695 139223 112386.09 102695 129909 1333781 1333781 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 6134 15.2% 94.3 3.00sec 19447 0 Direct 94.3 16390 32782 19447 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.27 94.27 0.00 0.00 0.0000 0.0000 1833221.88 1833221.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.69 81.35% 16390.18 16021 17623 16390.15 16021 17217 1257007 1257007 0.00
crit 17.58 18.65% 32781.91 32042 35246 32778.56 32042 34925 576215 576215 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3300 8.2% 17.6 17.14sec 56478 57235 Direct 17.6 4482 8962 5317 18.6%  
Periodic 233.0 3250 6495 3854 18.6% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.55 17.55 232.99 232.99 0.9868 1.2779 991255.06 991255.06 0.00 3146.14 57235.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.28 81.36% 4481.61 4112 5607 4482.78 4225 4759 63993 63993 0.00
crit 3.27 18.64% 8962.41 8225 11214 8729.61 0 11214 29328 29328 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 189.6 81.39% 3250.04 3 4065 3251.43 3167 3380 616311 616311 0.00
crit 43.4 18.61% 6494.56 94 8130 6497.42 6131 7046 281623 281623 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
focusing iris
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.78sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.59sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8736 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.6 56.4 42.5sec 4.7sec 93.19% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.87%
  • arcanic_pulsar_2:11.37%
  • arcanic_pulsar_3:11.11%
  • arcanic_pulsar_4:11.22%
  • arcanic_pulsar_5:11.21%
  • arcanic_pulsar_6:12.08%
  • arcanic_pulsar_7:12.08%
  • arcanic_pulsar_8:12.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.7sec 0.0sec 16.17% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.09% 8.31% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.48% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.0 0.0 39.4sec 39.4sec 26.52% 36.53% 0.0(0.0) 7.8

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.4sec 46.0sec 23.47% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Focused Energy 1.0 365.0 0.0sec 0.8sec 100.00% 99.72% 358.0(358.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_focused_energy
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:35.52

Stack Uptimes

  • focused_energy_3:0.41%
  • focused_energy_4:0.31%
  • focused_energy_5:0.40%
  • focused_energy_6:0.29%
  • focused_energy_7:0.21%
  • focused_energy_8:0.20%
  • focused_energy_9:0.23%
  • focused_energy_10:97.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295248
  • name:Focused Energy
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc295246=Your damaging spells and abilities grant you {$s2=0} Haste for {$295248d=4 seconds}, stacking up to {$295248u=10} times. This Haste is lost if you stop using spells or abilities against the initial target.$?a295252[ When you have no stacks of Focused Energy, generate {$s1=1} stacks from your first damaging spell or ability.][]}
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
Fury of Elune 5.4 0.0 60.8sec 60.8sec 14.14% 0.00% 84.9(84.9) 5.2

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.24% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.80%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 43.7 42.2 7.0sec 3.5sec 76.97% 99.62% 2.0(2.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:38.83%
  • lunar_empowerment_2:24.93%
  • lunar_empowerment_3:13.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.7 3.8 63.5sec 32.6sec 49.41% 0.00% 3.8(52.5) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.40%
  • overwhelming_power_2:1.44%
  • overwhelming_power_3:1.48%
  • overwhelming_power_4:1.53%
  • overwhelming_power_5:1.57%
  • overwhelming_power_6:1.61%
  • overwhelming_power_7:1.66%
  • overwhelming_power_8:1.71%
  • overwhelming_power_9:1.76%
  • overwhelming_power_10:1.81%
  • overwhelming_power_11:1.87%
  • overwhelming_power_12:1.92%
  • overwhelming_power_13:1.98%
  • overwhelming_power_14:2.04%
  • overwhelming_power_15:2.10%
  • overwhelming_power_16:2.16%
  • overwhelming_power_17:2.23%
  • overwhelming_power_18:2.30%
  • overwhelming_power_19:2.37%
  • overwhelming_power_20:2.45%
  • overwhelming_power_21:2.53%
  • overwhelming_power_22:2.61%
  • overwhelming_power_23:2.70%
  • overwhelming_power_24:2.77%
  • overwhelming_power_25:1.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 31.1 49.6 9.7sec 3.7sec 81.40% 73.15% 0.1(0.1) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:34.80%
  • solar_empowerment_2:34.71%
  • solar_empowerment_3:11.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 48.9 20.3sec 4.7sec 97.72% 93.27% 18.8(18.8) 12.4

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.81%
  • starlord_2:22.43%
  • starlord_3:60.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 61.1sec 45.9sec 23.62% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.62%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
focusing iris
starsurge Astral Power 64.1 2565.3 40.0 40.0 1660.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 108.23 865.56 (34.24%) 8.00 0.26 0.03%
celestial_alignment Astral Power 2.00 80.00 (3.16%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.89 212.22 (8.40%) 2.50 0.01 0.00%
sunfire Astral Power 17.55 52.65 (2.08%) 3.00 0.00 0.00%
moonfire Astral Power 14.21 42.63 (1.69%) 3.00 0.00 0.00%
lunar_strike Astral Power 82.89 994.30 (39.33%) 12.00 0.32 0.03%
natures_balance Astral Power 401.52 200.75 (7.94%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.64 79.74 (3.15%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.40 8.53
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 18.96 0.00 72.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data focusing iris Fight Length
Count 3985
Mean 300.77
Minimum 240.06
Maximum 359.83
Spread ( max - min ) 119.77
Range [ ( max - min ) / 2 * 100% ] 19.91%
DPS
Sample Data focusing iris Damage Per Second
Count 3985
Mean 40211.41
Minimum 36742.35
Maximum 44428.87
Spread ( max - min ) 7686.52
Range [ ( max - min ) / 2 * 100% ] 9.56%
Standard Deviation 1184.2543
5th Percentile 38381.63
95th Percentile 42226.87
( 95th Percentile - 5th Percentile ) 3845.24
Mean Distribution
Standard Deviation 18.7599
95.00% Confidence Intervall ( 40174.64 - 40248.18 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3332
0.1 Scale Factor Error with Delta=300 11973
0.05 Scale Factor Error with Delta=300 47889
0.01 Scale Factor Error with Delta=300 1197220
Priority Target DPS
Sample Data focusing iris Priority Target Damage Per Second
Count 3985
Mean 40211.41
Minimum 36742.35
Maximum 44428.87
Spread ( max - min ) 7686.52
Range [ ( max - min ) / 2 * 100% ] 9.56%
Standard Deviation 1184.2543
5th Percentile 38381.63
95th Percentile 42226.87
( 95th Percentile - 5th Percentile ) 3845.24
Mean Distribution
Standard Deviation 18.7599
95.00% Confidence Intervall ( 40174.64 - 40248.18 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3332
0.1 Scale Factor Error with Delta=300 11973
0.05 Scale Factor Error with Delta=300 47889
0.01 Scale Factor Error with Delta=300 1197220
DPS(e)
Sample Data focusing iris Damage Per Second (Effective)
Count 3985
Mean 40211.41
Minimum 36742.35
Maximum 44428.87
Spread ( max - min ) 7686.52
Range [ ( max - min ) / 2 * 100% ] 9.56%
Damage
Sample Data focusing iris Damage
Count 3985
Mean 12069820.55
Minimum 9257841.74
Maximum 14815602.55
Spread ( max - min ) 5557760.81
Range [ ( max - min ) / 2 * 100% ] 23.02%
DTPS
Sample Data focusing iris Damage Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data focusing iris Healing Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data focusing iris Healing Per Second (Effective)
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data focusing iris Heal
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data focusing iris Healing Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data focusing iris Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data focusing irisTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data focusing iris Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.37 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 1.87 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 64.13 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.79 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.50 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.58 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.71 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 83.24 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 107.49 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.19 sunfire

Sample Sequence

012345678ACDKONPHFGIKQKQKQPQKQPQKNQOQPQKQPQKLPPPKQPQKQPQMPQQQQQJKKPNPKQPQQKPQQQOQQQKNPKIQPKQPQQQQQJKNKQKQMPPKPPQQPQQNQKKOPQPKQPQKPQQNQQQQKPKQPQGKIQMPKPNKPPQPQKPKQPOPQKPNQPKPQQPQKPQKQPQKQPNOPKQPQQQQKPPHEFIKNKOQPKQPQKQPQPQKQPKNQPKQMPKPQPQPQPKNQPKQPQOPKQPQPNQJKKQGPIKQPPQQQKOKQPQPLQKKPPQKPQQQKPQQNOQQQPKKPPQQKPPNQQQOQQQJKQKQPIKPQNPQKQPPJKOQKQPQPKQPKQPPK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask focusing iris 58.0/100: 58% astral_power
Pre precombat 1 food focusing iris 58.0/100: 58% astral_power
Pre precombat 2 augmentation focusing iris 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power focused_energy(3), battle_potion_of_intellect
0:01.222 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(3), battle_potion_of_intellect
0:02.137 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(4), battle_potion_of_intellect
0:03.048 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(5), battle_potion_of_intellect
0:04.204 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, focused_energy(7), battle_potion_of_intellect
0:04.986 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect
0:04.986 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect
0:04.986 default I fury_of_elune Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect, ignition_mages_fuse
0:05.741 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord, focused_energy(9), battle_potion_of_intellect, ignition_mages_fuse
0:06.498 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:07.253 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(25), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:08.009 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:08.763 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:09.517 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.271 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.026 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.782 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.539 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.294 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.047 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.803 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.558 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.313 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.067 default O moonfire Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.821 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.576 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(25), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.330 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.084 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), overwhelming_power(23), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.838 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(23), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.592 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(22), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.355 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(21), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.110 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(20), focused_energy(10), ignition_mages_fuse(5)
0:23.864 default L sunfire Fluffy_Pillow 1.5/100: 2% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(20), focused_energy(10), ignition_mages_fuse(5)
0:24.620 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(19), focused_energy(10), ignition_mages_fuse(5)
0:25.478 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(18), focused_energy(10)
0:26.511 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(17), focused_energy(10)
0:27.547 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(16), focused_energy(10)
0:28.364 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), focused_energy(10)
0:29.118 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), focused_energy(10)
0:30.004 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(13), focused_energy(10)
0:30.759 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, celestial_alignment, starlord(3), overwhelming_power(13), focused_energy(10)
0:31.516 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), focused_energy(10)
0:32.270 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(11), focused_energy(10)
0:33.164 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(10), focused_energy(10)
0:33.918 default M moonfire Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(10), focused_energy(10)
0:34.672 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(9), focused_energy(10)
0:35.708 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(8), focused_energy(10)
0:36.523 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(7), focused_energy(10)
0:37.342 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(6), focused_energy(10)
0:38.162 default Q solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(5), focused_energy(10)
0:38.985 default Q solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(5), focused_energy(10)
0:39.812 default J cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(4), focused_energy(10)
0:39.812 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar, overwhelming_power(4), focused_energy(10)
0:40.713 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(3), focused_energy(10)
0:41.593 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(2), focused_energy(10)
0:43.009 default N sunfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
0:44.130 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
0:45.556 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), focused_energy(10)
0:46.677 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
0:47.604 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
0:48.991 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), focused_energy(10)
0:49.918 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), focused_energy(10)
0:50.844 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), starlord(3), focused_energy(10)
0:51.934 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
0:53.322 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), focused_energy(10)
0:54.248 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), starlord(3), focused_energy(10)
0:55.340 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), starlord(3), focused_energy(10)
0:56.429 default O moonfire Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), starlord(3), focused_energy(10)
0:57.519 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), starlord(3), focused_energy(10)
0:58.608 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(5), starlord(3), focused_energy(10)
0:59.697 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(5), starlord(3), focused_energy(10)
1:00.787 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(5), focused_energy(10)
1:01.973 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:03.129 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:04.597 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, focused_energy(10)
1:05.751 default I fury_of_elune Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), focused_energy(10)
1:06.871 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), focused_energy(10)
1:07.826 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
1:09.253 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), focused_energy(10)
1:10.375 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
1:11.300 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:12.688 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(3), focused_energy(10)
1:13.614 default Q solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment, starlord(3), focused_energy(10)
1:14.540 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
1:15.627 default Q solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
1:16.719 default Q solar_wrath Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
1:17.809 default J cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
1:17.809 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(8), focused_energy(10)
1:18.997 default N sunfire Fluffy_Pillow 73.0/100: 73% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:20.000 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:21.003 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
1:21.831 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10)
1:22.805 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10)
1:23.613 default M moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10)
1:24.563 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10)
1:25.950 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10)
1:27.336 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
1:28.425 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
1:29.814 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:31.201 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), focused_energy(10)
1:32.124 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
1:33.050 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
1:34.436 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:35.526 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:36.616 default N sunfire Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:37.704 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:38.792 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:39.980 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:41.135 default O moonfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:42.256 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:43.684 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(24), focused_energy(10), conch_of_dark_whispers
1:44.561 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23), focused_energy(10), conch_of_dark_whispers
1:45.879 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22), focused_energy(10), conch_of_dark_whispers
1:46.916 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(21), focused_energy(10), conch_of_dark_whispers
1:47.778 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), focused_energy(10)
1:49.074 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(18), focused_energy(10)
1:49.946 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(18), focused_energy(10)
1:50.971 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), focused_energy(10)
1:52.243 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), focused_energy(10)
1:53.098 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), focused_energy(10)
1:53.958 default N sunfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(22), focused_energy(10)
1:54.969 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(21), focused_energy(10)
1:55.983 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(20), focused_energy(10)
1:57.000 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(18), focused_energy(10)
1:58.022 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(17), focused_energy(10)
1:59.049 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(7), torrent_of_elements, overwhelming_power(16), focused_energy(10)
2:00.173 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(15), focused_energy(10)
2:01.568 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(14), focused_energy(10)
2:02.666 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(13), focused_energy(10)
2:03.457 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(12), focused_energy(10)
2:04.647 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power celestial_alignment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(11), focused_energy(10)
2:05.446 default G use_items Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(10), focused_energy(10)
2:05.446 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(10), focused_energy(10), ignition_mages_fuse
2:06.350 default I fury_of_elune Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(9), focused_energy(10), ignition_mages_fuse
2:07.231 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(8), focused_energy(10), ignition_mages_fuse
2:07.985 default M moonfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), overwhelming_power(8), focused_energy(10), ignition_mages_fuse
2:08.870 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), starlord(3), overwhelming_power(7), focused_energy(10), ignition_mages_fuse
2:10.171 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starlord(3), overwhelming_power(5), focused_energy(10), ignition_mages_fuse(2)
2:11.160 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(4), focused_energy(10), ignition_mages_fuse(2)
2:12.423 default N sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(3), focused_energy(10), ignition_mages_fuse(2)
2:13.417 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(2), focused_energy(10), ignition_mages_fuse(2)
2:14.417 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power, focused_energy(10), ignition_mages_fuse(3)
2:15.645 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(3)
2:16.875 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(3)
2:17.696 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(4)
2:18.882 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(4)
2:19.676 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(3), lunar_empowerment, focused_energy(10), ignition_mages_fuse(4)
2:20.691 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, focused_energy(10), ignition_mages_fuse(4)
2:21.947 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10), ignition_mages_fuse(5)
2:22.900 default Q solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), focused_energy(10), ignition_mages_fuse(5)
2:23.686 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), ignition_mages_fuse(5)
2:24.862 default O moonfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), ignition_mages_fuse(5)
2:25.787 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
2:27.214 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), focused_energy(10)
2:28.166 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), focused_energy(10)
2:29.287 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
2:30.675 default N sunfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), focused_energy(10)
2:31.765 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), focused_energy(10)
2:32.691 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
2:34.079 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), focused_energy(10)
2:35.169 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10)
2:36.448 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(23), focused_energy(10)
2:37.303 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(22), focused_energy(10)
2:38.162 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), overwhelming_power(21), focused_energy(10)
2:39.453 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(20), focused_energy(10)
2:40.470 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(7), overwhelming_power(19), focused_energy(10)
2:41.583 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18), focused_energy(10)
2:42.962 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(17), focused_energy(10)
2:43.887 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), starlord, overwhelming_power(16), focused_energy(10)
2:44.977 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(15), focused_energy(10)
2:45.764 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(14), focused_energy(10)
2:46.945 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, solar_empowerment, starlord(2), overwhelming_power(13), focused_energy(10)
2:47.736 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, starlord(2), overwhelming_power(12), focused_energy(10)
2:48.670 default Q solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), focused_energy(10)
2:49.445 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), focused_energy(10)
2:50.610 default N sunfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), focused_energy(10)
2:51.666 default O moonfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), focused_energy(10)
2:52.725 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(7), focused_energy(10)
2:54.078 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5), focused_energy(10)
2:55.150 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(4), focused_energy(10)
2:56.062 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3), focused_energy(10)
2:57.437 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), focused_energy(10)
2:58.356 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, focused_energy(10)
2:59.279 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, focused_energy(10)
3:00.371 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, focused_energy(10)
3:01.461 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(2), lunar_empowerment, torrent_of_elements, focused_energy(10)
3:02.650 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, focused_energy(10)
3:04.117 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, focused_energy(10)
3:05.585 default H celestial_alignment Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment, starlord, torrent_of_elements, focused_energy(10)
3:06.589 default E potion Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment, starlord, torrent_of_elements, focused_energy(10)
3:06.589 default F berserking Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment, starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:06.589 default I fury_of_elune Fluffy_Pillow 89.5/100: 90% astral_power berserking, arcanic_pulsar(3), celestial_alignment, solar_empowerment, starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:07.502 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, solar_empowerment, starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:08.414 default N sunfire Fluffy_Pillow 58.5/100: 59% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:09.299 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:10.184 default O moonfire Fluffy_Pillow 32.5/100: 33% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:11.047 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:11.801 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:12.900 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:13.762 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power berserking, arcanic_pulsar(6), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:14.516 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(6), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:15.613 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect
3:16.367 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect
3:17.231 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect
3:17.986 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect
3:19.084 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect
3:19.892 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect
3:21.097 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect
3:22.044 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), focused_energy(10), battle_potion_of_intellect
3:23.078 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, focused_energy(10), battle_potion_of_intellect
3:23.932 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord, focused_energy(10), battle_potion_of_intellect
3:25.210 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord, focused_energy(10), battle_potion_of_intellect
3:26.214 default N sunfire Fluffy_Pillow 36.5/100: 37% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), focused_energy(10), battle_potion_of_intellect
3:27.188 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), focused_energy(10), battle_potion_of_intellect
3:28.017 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power celestial_alignment, lunar_empowerment(3), starlord(2), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:29.259 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:30.233 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:31.041 default M moonfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:31.988 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
3:33.375 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
3:34.465 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
3:35.853 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
3:36.781 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
3:38.169 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
3:39.094 default P lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
3:40.482 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
3:41.410 default P lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
3:42.797 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(2), solar_empowerment(2), focused_energy(10), conch_of_dark_whispers
3:43.984 default N sunfire Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, focused_energy(10), conch_of_dark_whispers
3:45.138 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, focused_energy(10)
3:46.119 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, focused_energy(10)
3:47.589 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10)
3:48.742 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), focused_energy(10)
3:49.696 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
3:51.121 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), focused_energy(10)
3:52.073 default O moonfire Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
3:53.193 default P lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
3:54.619 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
3:55.740 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10)
3:56.664 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
3:58.050 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
3:58.979 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
4:00.366 default N sunfire Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), focused_energy(10)
4:01.457 default Q solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), focused_energy(10)
4:02.383 default J cancel_buff Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), focused_energy(10)
4:02.383 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(5), solar_empowerment, focused_energy(10)
4:03.570 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10)
4:04.724 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), focused_energy(10)
4:05.678 default G use_items Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
4:05.678 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), ignition_mages_fuse
4:07.049 default I fury_of_elune Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), focused_energy(10), ignition_mages_fuse
4:08.043 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23), focused_energy(10), ignition_mages_fuse
4:09.038 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22), focused_energy(10), ignition_mages_fuse
4:09.865 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), focused_energy(10), ignition_mages_fuse(2)
4:11.057 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.256 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(19), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.058 default Q solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment, starlord(3), overwhelming_power(18), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.863 default Q solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(8), fury_of_elune, starlord(3), overwhelming_power(18), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:14.779 default K starsurge Fluffy_Pillow 97.5/100: 98% astral_power arcanic_pulsar(8), fury_of_elune, starlord(3), overwhelming_power(17), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:15.698 default O moonfire Fluffy_Pillow 72.5/100: 73% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(16), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.498 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.301 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.054 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.048 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.805 default P lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(12), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.802 default L sunfire Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(11), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.586 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar, starlord(3), overwhelming_power(10), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.491 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar, overwhelming_power(9), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:23.447 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(8), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.377 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.532 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(6), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.690 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(5), focused_energy(10), conch_of_dark_whispers
4:27.626 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(25), focused_energy(10), conch_of_dark_whispers
4:28.654 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers
4:29.931 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(23), focused_energy(10), conch_of_dark_whispers
4:30.786 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(22), focused_energy(10), conch_of_dark_whispers
4:31.645 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(21), focused_energy(10), conch_of_dark_whispers
4:32.658 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(20), focused_energy(10), conch_of_dark_whispers
4:33.674 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19), focused_energy(10), conch_of_dark_whispers
4:34.974 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(18), focused_energy(10)
4:35.844 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(17), focused_energy(10)
4:36.872 default N sunfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(16), focused_energy(10)
4:37.903 default O moonfire Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(15), focused_energy(10)
4:38.937 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(14), focused_energy(10)
4:39.975 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(13), focused_energy(10)
4:41.016 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(11), focused_energy(10)
4:42.065 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10), focused_energy(10)
4:43.405 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(5), torrent_of_elements, overwhelming_power(9), focused_energy(10)
4:44.556 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(8), focused_energy(10)
4:45.675 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7), focused_energy(10)
4:47.067 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5), focused_energy(10)
4:48.469 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(4), focused_energy(10)
4:49.408 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(3), focused_energy(10)
4:50.351 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(2), focused_energy(10)
4:51.462 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, focused_energy(10)
4:52.845 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
4:54.233 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
4:55.322 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
4:56.249 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
4:57.339 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
4:58.426 default O moonfire Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
4:59.515 default Q solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
5:00.605 default Q solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
5:01.694 default Q solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
5:02.784 default J cancel_buff Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
5:02.784 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(8), focused_energy(10)
5:03.971 default Q solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
5:04.825 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power celestial_alignment, lunar_empowerment, starlord, focused_energy(10)
5:05.832 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10)
5:06.661 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), focused_energy(10)
5:07.903 default I fury_of_elune Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10)
5:08.878 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10)
5:09.852 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10)
5:11.241 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
5:12.168 default N sunfire Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
5:13.258 default P lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
5:14.646 default Q solar_wrath Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
5:15.573 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
5:16.663 default Q solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
5:17.590 default P lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
5:18.979 default P lunar_strike Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
5:20.368 default J cancel_buff Fluffy_Pillow 98.0/100: 98% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
5:20.368 default K starsurge Fluffy_Pillow 98.0/100: 98% astral_power arcanic_pulsar(3), solar_empowerment(2), focused_energy(10), conch_of_dark_whispers
5:21.554 default O moonfire Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, focused_energy(10), conch_of_dark_whispers
5:22.707 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, focused_energy(10), conch_of_dark_whispers
5:23.687 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(25), focused_energy(10), conch_of_dark_whispers
5:24.744 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers
5:25.620 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), focused_energy(10)
5:26.937 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(22), focused_energy(10)
5:27.820 default P lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), focused_energy(10)
5:29.146 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19), focused_energy(10)
5:30.196 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18), focused_energy(10)
5:31.067 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17), focused_energy(10)
5:32.374 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16), focused_energy(10)
5:33.405 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(15), focused_energy(10)
5:34.284 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14), focused_energy(10)
5:35.606 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13), focused_energy(10)
5:36.932 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(12), focused_energy(10)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="focusing iris"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

life-force : 40180 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
40179.7 40179.7 38.7 / 0.096% 4769.1 / 11.9% 4862.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.2 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
life-force 40180
Azerite Spike 883 2.2% 16.8 17.24sec 15817 0 Direct 16.8 13337 26672 15831 18.7%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.77 16.75 0.00 0.00 0.0000 0.0000 265173.45 265173.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.62 81.30% 13336.86 12872 14867 13328.34 12872 14187 181640 181640 0.00
crit 3.13 18.70% 26671.58 25743 29734 25677.27 0 29734 83533 83533 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295835
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:90.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295835
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:{$@spelldesc295834=Your spells and abilities have a high chance to impale your target with a spike of Azerite, causing ${$m1*(1+$@versadmg)} Fire damage.$?a295837[ When an Azerite spike deals damage, all damage you deal against that target is increased by {$295838s1=5}% for {$295838d=6 seconds}.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11696.33
  • base_dd_max:11696.33
  • base_dd_mult:1.00
 
Fury of Elune 900 2.2% 5.4 60.74sec 50217 50904 Direct 133.5 1707 3411 2023 18.5%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 133.49 143.60 0.00 0.9867 0.2959 269997.42 269997.42 0.00 5649.66 50904.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 108.79 81.50% 1707.33 1457 2086 1708.68 1599 1880 185735 185735 0.00
crit 24.70 18.50% 3411.11 2915 4173 3413.85 3057 3843 84262 84262 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 300 (429) 0.7% (1.1%) 8.2 33.21sec 15671 0 Direct 8.2 9261 18508 10965 18.4%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.24 8.24 0.00 0.00 0.0000 0.0000 90318.71 90318.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 81.57% 9260.92 8921 10304 9262.09 8921 10304 62221 62221 0.00
crit 1.52 18.43% 18507.88 17842 20607 14433.35 0 20607 28097 28097 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 129 0.3% 8.2 33.21sec 4706 0 Direct 8.2 3968 7937 4705 18.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.24 8.24 0.00 0.00 0.0000 0.0000 38760.13 38760.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.71 81.42% 3968.35 3823 4416 3967.80 0 4416 26614 26614 0.00
crit 1.53 18.58% 7937.39 7646 8832 6297.58 0 8832 12146 12146 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6082 15.2% 79.8 3.74sec 22914 17621 Direct 79.8 19302 38540 22914 18.8%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.76 79.76 0.00 0.00 1.3004 0.0000 1827474.26 1827474.26 0.00 17621.00 17621.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.78 81.23% 19301.55 10135 25422 19310.49 18595 20247 1250391 1250391 0.00
crit 14.97 18.77% 38540.15 20270 50843 38548.44 34681 43295 577083 577083 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3192 8.0% 14.1 21.41sec 68105 67915 Direct 14.1 3667 7329 4359 18.9%  
Periodic 224.2 3374 6745 4003 18.6% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.08 14.08 224.20 224.20 1.0029 1.3317 958750.09 958750.09 0.00 3066.32 67914.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.41 81.08% 3666.55 3280 4695 3669.64 3394 4026 41851 41851 0.00
crit 2.66 18.92% 7328.50 6559 9391 6879.62 0 9391 19520 19520 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.4 81.35% 3374.01 4 4371 3375.64 3277 3532 615376 615376 0.00
crit 41.8 18.65% 6744.90 122 8743 6747.45 6336 7201 282004 282004 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 3538 (5531) 8.8% (13.8%) 101.6 2.90sec 16363 17919 Direct 102.1 8780 17550 10415 18.6%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.55 102.06 0.00 0.00 0.9132 0.0000 1062969.97 1062969.97 0.00 17918.94 17918.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.04 81.36% 8780.39 7949 11380 8785.18 8502 9172 729129 729129 0.00
crit 19.02 18.64% 17550.22 15898 22760 17559.56 16136 19533 333841 333841 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1993 5.0% 75.8 3.87sec 7896 0 Direct 75.8 7896 0 7896 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.83 75.83 0.00 0.00 0.0000 0.0000 598743.39 598743.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.83 100.00% 7896.13 5962 17070 7899.61 6945 9099 598743 598743 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11923.38
  • base_dd_max:11923.38
  • base_dd_mult:1.00
 
Starsurge 13901 34.6% 62.0 4.88sec 67339 64662 Direct 61.8 57019 113740 67562 18.6%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.99 61.79 0.00 0.00 1.0414 0.0000 4174567.03 4174567.03 0.00 64661.82 64661.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.31 81.41% 57018.57 51347 73092 57045.97 54978 60665 2868351 2868351 0.00
crit 11.48 18.59% 113739.72 102695 146185 113817.47 102695 136454 1306216 1306216 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 6027 14.9% 91.1 3.08sec 19768 0 Direct 91.1 16665 33334 19768 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.09 91.09 0.00 0.00 0.0000 0.0000 1800701.19 1800701.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.13 81.38% 16664.77 16021 18504 16664.73 16043 17566 1235410 1235410 0.00
crit 16.96 18.62% 33334.34 32042 37008 33333.34 32042 36013 565291 565291 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3233 8.1% 17.9 16.76sec 54158 53184 Direct 17.9 4577 9173 5435 18.7%  
Periodic 223.5 3295 6585 3909 18.7% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.93 17.93 223.49 223.49 1.0183 1.3321 971085.35 971085.35 0.00 3073.40 53183.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.58 81.34% 4576.74 4112 5887 4577.89 4194 4932 66751 66751 0.00
crit 3.35 18.66% 9173.10 8225 11775 8993.21 0 11775 30691 30691 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.8 81.34% 3294.96 2 4268 3296.59 3202 3449 598952 598952 0.00
crit 41.7 18.66% 6585.45 4 8537 6588.22 6166 7187 274691 274691 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
life-force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.47sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.27sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9065 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.5 43.9sec 4.9sec 92.62% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:12.29%
  • arcanic_pulsar_2:10.21%
  • arcanic_pulsar_3:11.09%
  • arcanic_pulsar_4:10.65%
  • arcanic_pulsar_5:13.04%
  • arcanic_pulsar_6:11.51%
  • arcanic_pulsar_7:11.20%
  • arcanic_pulsar_8:12.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.6sec 0.0sec 16.17% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.09% 7.47% 0.0(0.0) 2.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.48% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.9sec 37.9sec 25.96% 35.86% 0.0(0.0) 8.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.5sec 46.0sec 23.44% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.4 0.0 60.8sec 60.8sec 14.15% 0.00% 85.0(85.0) 5.2

Buff details

  • buff initial source:life-force
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.23% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:life-force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 40.8 41.9 7.5sec 3.6sec 77.91% 99.77% 1.8(1.8) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:38.45%
  • lunar_empowerment_2:26.20%
  • lunar_empowerment_3:13.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.3sec 33.7sec 47.92% 0.00% 3.5(48.9) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.43%
  • overwhelming_power_22:2.51%
  • overwhelming_power_23:2.59%
  • overwhelming_power_24:2.66%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 29.4 48.5 10.3sec 3.9sec 82.42% 74.42% 0.1(0.1) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:33.61%
  • solar_empowerment_2:35.97%
  • solar_empowerment_3:12.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.7 20.3sec 4.9sec 97.63% 92.86% 16.6(16.6) 12.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.63%
  • starlord_2:22.30%
  • starlord_3:59.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.4 1.1 60.6sec 45.6sec 23.82% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:life-force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.82%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:life-force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:life-force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:life-force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:life-force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
life-force
starsurge Astral Power 62.0 2479.7 40.0 40.0 1683.5
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 102.56 820.02 (33.58%) 8.00 0.43 0.05%
celestial_alignment Astral Power 2.00 80.00 (3.28%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.94 212.35 (8.69%) 2.50 0.01 0.00%
sunfire Astral Power 17.93 53.79 (2.20%) 3.00 0.00 0.00%
moonfire Astral Power 14.08 42.23 (1.73%) 3.00 0.00 0.00%
lunar_strike Astral Power 79.75 956.70 (39.17%) 12.00 0.34 0.04%
natures_balance Astral Power 401.52 200.75 (8.22%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.37 76.43 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.12 8.24
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.84 0.00 65.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data life-force Fight Length
Count 3985
Mean 300.77
Minimum 240.06
Maximum 359.83
Spread ( max - min ) 119.77
Range [ ( max - min ) / 2 * 100% ] 19.91%
DPS
Sample Data life-force Damage Per Second
Count 3985
Mean 40179.72
Minimum 36181.38
Maximum 44509.92
Spread ( max - min ) 8328.54
Range [ ( max - min ) / 2 * 100% ] 10.36%
Standard Deviation 1248.0356
5th Percentile 38258.60
95th Percentile 42314.89
( 95th Percentile - 5th Percentile ) 4056.29
Mean Distribution
Standard Deviation 19.7703
95.00% Confidence Intervall ( 40140.97 - 40218.47 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3707
0.1 Scale Factor Error with Delta=300 13297
0.05 Scale Factor Error with Delta=300 53187
0.01 Scale Factor Error with Delta=300 1329651
Priority Target DPS
Sample Data life-force Priority Target Damage Per Second
Count 3985
Mean 40179.72
Minimum 36181.38
Maximum 44509.92
Spread ( max - min ) 8328.54
Range [ ( max - min ) / 2 * 100% ] 10.36%
Standard Deviation 1248.0356
5th Percentile 38258.60
95th Percentile 42314.89
( 95th Percentile - 5th Percentile ) 4056.29
Mean Distribution
Standard Deviation 19.7703
95.00% Confidence Intervall ( 40140.97 - 40218.47 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3707
0.1 Scale Factor Error with Delta=300 13297
0.05 Scale Factor Error with Delta=300 53187
0.01 Scale Factor Error with Delta=300 1329651
DPS(e)
Sample Data life-force Damage Per Second (Effective)
Count 3985
Mean 40179.72
Minimum 36181.38
Maximum 44509.92
Spread ( max - min ) 8328.54
Range [ ( max - min ) / 2 * 100% ] 10.36%
Damage
Sample Data life-force Damage
Count 3985
Mean 12058540.99
Minimum 9408128.97
Maximum 14734258.07
Spread ( max - min ) 5326129.10
Range [ ( max - min ) / 2 * 100% ] 22.08%
DTPS
Sample Data life-force Damage Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data life-force Healing Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data life-force Healing Per Second (Effective)
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data life-force Heal
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data life-force Healing Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data life-force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data life-forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data life-force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.38 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.33 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.99 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.03 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.86 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.76 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.22 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 80.11 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 101.81 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.14 sunfire

Sample Sequence

012345678ACDKONPHFGIKQKQPKQPKQPKNQPOQPQKQPQLPPKQPKQPKQPQKMPPQPKNQPQKQPQKPQQQQQONKPPIKQPKQPPQQQJKNKQPKMPPKQPPQQNPQKKPOPQKPQQQKPNQQQQKPPKQGIQKQMPKNPPQQQQKKPPQPKOPNQKPQQQQQKPQKPQQNOQKQPQPLQQKKPPPHEFIKOQKQPKNQPQPQKQKQPKMPPQQPNQQQJKQKQKQMPPKPPNQQQQPKKPPQGKPOQINKQPPQQQJKKQPKQPQLKPPOQKPQQQPKPQQKNPQQQKOPPQQQKPNKPQQPIKQKQPQMPQKKNPPQKPQQQKPQQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask life-force 58.0/100: 58% astral_power
Pre precombat 1 food life-force 58.0/100: 58% astral_power
Pre precombat 2 augmentation life-force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.241 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.165 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.092 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.271 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, battle_potion_of_intellect
0:05.076 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, battle_potion_of_intellect
0:05.076 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, battle_potion_of_intellect
0:05.076 default I fury_of_elune Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.832 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment(2), starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.587 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.341 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.096 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.850 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.695 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.449 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.204 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.014 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.768 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.521 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.299 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.054 default N sunfire Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.809 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.562 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.342 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.095 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.848 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.672 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.427 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.181 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.935 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.777 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.531 default L sunfire Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, ignition_mages_fuse(5)
0:24.285 default P lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord, ignition_mages_fuse(5)
0:25.253 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord
0:26.432 default K starsurge Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord
0:27.357 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2)
0:28.121 default P lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:29.268 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
0:30.168 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:30.924 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:31.894 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
0:32.655 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:33.409 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:34.378 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
0:35.132 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:35.892 default M moonfire Fluffy_Pillow 4.5/100: 5% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
0:36.655 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3)
0:37.770 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:38.886 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3)
0:39.641 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3)
0:40.757 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar(2), solar_empowerment(2)
0:41.709 default N sunfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord
0:42.910 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord
0:43.932 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
0:45.465 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord, conch_of_dark_whispers
0:46.489 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, conch_of_dark_whispers
0:47.691 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers
0:48.683 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:50.172 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:51.163 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), conch_of_dark_whispers
0:52.333 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:53.781 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), conch_of_dark_whispers
0:54.747 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:55.715 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), conch_of_dark_whispers
0:56.683 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), starlord(3), conch_of_dark_whispers
0:57.819 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(5), starlord(3), conch_of_dark_whispers
0:58.953 default O moonfire Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), conch_of_dark_whispers
1:00.088 default N sunfire Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), conch_of_dark_whispers
1:01.225 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(5), lunar_empowerment, conch_of_dark_whispers
1:02.462 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers
1:03.993 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
1:05.524 default I fury_of_elune Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord
1:06.726 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(2), starlord
1:07.930 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2)
1:08.924 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:10.414 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2)
1:11.583 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:12.550 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:13.998 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:15.444 default Q solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
1:16.411 default Q solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
1:17.379 default Q solar_wrath Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(8), starlord(3)
1:18.515 default J cancel_buff Fluffy_Pillow 97.0/100: 97% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3)
1:18.515 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power arcanic_pulsar(8), lunar_empowerment
1:19.753 default N sunfire Fluffy_Pillow 70.0/100: 70% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord
1:20.800 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord
1:21.846 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2)
1:22.712 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2)
1:24.006 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
1:25.024 default M moonfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:26.014 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:27.463 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:28.910 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3)
1:30.045 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:31.010 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:32.458 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:33.905 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
1:34.872 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements
1:35.839 default N sunfire Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25)
1:36.878 default P lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24)
1:38.206 default Q solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22)
1:39.101 default K starsurge Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(3), torrent_of_elements, overwhelming_power(21)
1:40.249 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
1:41.367 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
1:42.755 default O moonfire Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
1:43.850 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
1:45.211 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
1:46.125 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
1:47.205 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
1:48.546 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
1:49.446 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
1:50.349 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
1:51.415 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
1:52.484 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers
1:53.849 default N sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers
1:54.925 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
1:55.842 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(13)
1:56.926 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(12)
1:58.013 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(10)
1:59.108 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(7), lunar_empowerment, overwhelming_power(9)
2:00.307 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(8)
2:01.795 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(7)
2:03.288 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(5)
2:04.470 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4)
2:05.322 default G use_items Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(3)
2:05.322 default I fury_of_elune Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(3), ignition_mages_fuse
2:06.488 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(2), ignition_mages_fuse
2:07.308 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, starlord(2), overwhelming_power, ignition_mages_fuse
2:08.279 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse
2:09.085 default M moonfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), ignition_mages_fuse
2:10.033 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:11.363 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), ignition_mages_fuse(2)
2:12.408 default N sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:13.453 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
2:14.733 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
2:16.012 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
2:16.867 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), ignition_mages_fuse(3)
2:17.721 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(2), starlord(3), ignition_mages_fuse(4)
2:18.688 default Q solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(2), starlord(3), ignition_mages_fuse(4)
2:19.655 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(2), ignition_mages_fuse(4)
2:20.707 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse(4)
2:21.727 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
2:22.947 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
2:24.165 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
2:24.981 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), ignition_mages_fuse(5)
2:26.200 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2)
2:27.367 default O moonfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
2:28.504 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
2:29.953 default N sunfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
2:31.088 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
2:32.054 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3)
2:33.191 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
2:34.639 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
2:35.604 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
2:36.571 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), starlord(3)
2:37.707 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), starlord(3)
2:38.843 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), starlord(3)
2:39.979 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(6)
2:41.219 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
2:42.750 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), solar_empowerment, starlord
2:43.772 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), starlord
2:44.974 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2)
2:46.463 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2)
2:47.456 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2)
2:48.451 default N sunfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), starlord(2)
2:49.620 default O moonfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), starlord(2)
2:50.788 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), starlord(2)
2:51.956 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), starlord(2)
2:53.125 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
2:53.966 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, lunar_empowerment, starlord(3)
2:55.226 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, starlord(3)
2:56.214 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power celestial_alignment, starlord(3)
2:57.695 default L sunfire Fluffy_Pillow 64.0/100: 64% astral_power celestial_alignment, starlord(3), conch_of_dark_whispers
2:58.683 default Q solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power starlord(3), conch_of_dark_whispers
2:59.819 default Q solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power starlord(3), conch_of_dark_whispers
3:00.956 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power lunar_empowerment, conch_of_dark_whispers
3:02.196 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers
3:03.400 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:04.889 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:06.378 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:07.867 default H celestial_alignment Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:08.885 default E potion Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:08.885 default F berserking Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:08.885 default I fury_of_elune Fluffy_Pillow 86.5/100: 87% astral_power berserking, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:09.809 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:10.731 default O moonfire Fluffy_Pillow 55.5/100: 56% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:11.629 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:12.392 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:13.291 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:14.055 default P lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:15.198 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:16.097 default N sunfire Fluffy_Pillow 37.5/100: 38% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:16.996 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:17.761 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:18.906 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect
3:19.662 default P lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect
3:20.717 default Q solar_wrath Fluffy_Pillow 88.5/100: 89% astral_power berserking, arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect
3:21.471 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power arcanic_pulsar(5), celestial_alignment, overwhelming_power(21), battle_potion_of_intellect
3:22.471 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20), battle_potion_of_intellect
3:23.300 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord, overwhelming_power(19), battle_potion_of_intellect
3:24.277 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(18), battle_potion_of_intellect
3:25.089 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(17), battle_potion_of_intellect
3:26.310 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(16), battle_potion_of_intellect
3:27.270 default M moonfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), battle_potion_of_intellect
3:28.207 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), battle_potion_of_intellect
3:29.583 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), battle_potion_of_intellect
3:30.964 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(12), battle_potion_of_intellect
3:31.889 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(11), battle_potion_of_intellect
3:32.981 default P lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(10), battle_potion_of_intellect
3:34.376 default N sunfire Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(8)
3:35.479 default Q solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(7)
3:36.586 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(6)
3:37.698 default Q solar_wrath Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(5)
3:38.813 default J cancel_buff Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(4)
3:38.813 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar(8), overwhelming_power(4)
3:40.034 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(2)
3:40.917 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(2)
3:41.954 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power
3:42.814 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), conch_of_dark_whispers
3:43.829 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
3:44.669 default M moonfire Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers
3:45.658 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), conch_of_dark_whispers
3:47.106 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), conch_of_dark_whispers
3:48.555 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), conch_of_dark_whispers
3:49.692 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
3:51.140 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
3:52.587 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), conch_of_dark_whispers
3:53.723 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), conch_of_dark_whispers
3:54.691 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(3), starlord(3), conch_of_dark_whispers
3:55.828 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(25), conch_of_dark_whispers
3:56.867 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(24), conch_of_dark_whispers
3:57.911 default P lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power(23)
3:59.244 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(3), overwhelming_power(25)
4:00.376 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24)
4:01.480 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23)
4:02.851 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22)
4:04.225 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(20)
4:05.151 default G use_items Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), overwhelming_power(19)
4:05.151 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), overwhelming_power(19), ignition_mages_fuse
4:06.202 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), ignition_mages_fuse
4:07.505 default O moonfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(17), ignition_mages_fuse
4:08.531 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(16), ignition_mages_fuse
4:09.406 default I fury_of_elune Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(15), ignition_mages_fuse(2)
4:10.400 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(14), ignition_mages_fuse(2)
4:11.395 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(13), ignition_mages_fuse(2)
4:12.394 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(12), ignition_mages_fuse(2)
4:13.246 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), ignition_mages_fuse(3)
4:14.480 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), ignition_mages_fuse(3)
4:15.663 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(23), ignition_mages_fuse(3)
4:16.456 default Q solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment, starlord(3), overwhelming_power(22), ignition_mages_fuse(3)
4:17.251 default Q solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(7), fury_of_elune, starlord(3), overwhelming_power(21), ignition_mages_fuse(4)
4:18.156 default J cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(20), ignition_mages_fuse(4)
4:18.156 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(7), overwhelming_power(20), ignition_mages_fuse(4)
4:19.147 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(19), ignition_mages_fuse(4)
4:20.111 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.866 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.905 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(5)
4:22.696 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(5)
4:23.451 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.438 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.192 default L sunfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), conch_of_dark_whispers
4:26.134 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers
4:27.221 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
4:28.611 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
4:30.007 default O moonfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(8), conch_of_dark_whispers
4:31.111 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers
4:32.052 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(6), conch_of_dark_whispers
4:33.165 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), conch_of_dark_whispers
4:34.586 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(4), conch_of_dark_whispers
4:35.538 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(3), conch_of_dark_whispers
4:36.495 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(2), conch_of_dark_whispers
4:37.623 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power, conch_of_dark_whispers
4:39.063 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(3), solar_empowerment, conch_of_dark_whispers
4:40.301 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
4:41.832 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord
4:42.855 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord
4:43.878 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), solar_empowerment, starlord
4:45.081 default N sunfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
4:46.249 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
4:47.739 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2)
4:48.733 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), torrent_of_elements
4:49.726 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), starlord(2), torrent_of_elements
4:50.893 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(2), torrent_of_elements
4:52.062 default O moonfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
4:53.198 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
4:54.644 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
4:56.092 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements
4:57.059 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements
4:58.195 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements
4:59.331 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(6), torrent_of_elements
5:00.569 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
5:02.100 default N sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements
5:03.302 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), solar_empowerment, starlord
5:04.505 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
5:05.994 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2)
5:06.987 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2)
5:07.983 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(2)
5:09.472 default I fury_of_elune Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2)
5:10.641 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment, starlord(2)
5:11.810 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3)
5:12.650 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3)
5:13.639 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3)
5:14.478 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3)
5:15.737 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3)
5:16.578 default M moonfire Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3)
5:17.566 default P lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, lunar_empowerment, starlord(3)
5:19.012 default Q solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar, starlord(3)
5:20.149 default K starsurge Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar
5:21.387 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord
5:22.590 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
5:23.759 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
5:25.249 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
5:26.737 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2)
5:27.731 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2)
5:28.901 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
5:30.351 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3)
5:31.317 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3)
5:32.284 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), starlord(3)
5:33.420 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), starlord(3)
5:34.555 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24)
5:35.884 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(25)
5:36.767 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(24)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="life-force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

lucid dreams : 40352 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
40351.8 40351.8 40.3 / 0.100% 5044.3 / 12.5% 4555.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.8 8.7 Astral Power 0.00% 58.5 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
lucid dreams 40352
Fury of Elune 898 2.2% 5.4 60.79sec 50123 50940 Direct 134.0 1698 3387 2009 18.4%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.37 133.98 143.91 0.00 0.9841 0.2948 269218.57 269218.57 0.00 5642.58 50940.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 109.27 81.55% 1697.79 1457 2071 1699.52 1593 1856 185509 185509 0.00
crit 24.71 18.45% 3387.30 2915 4142 3390.63 3066 3804 83710 83710 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 301 (430) 0.7% (1.1%) 8.3 33.18sec 15617 0 Direct 8.3 9215 18448 10925 18.5%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.28 8.28 0.00 0.00 0.0000 0.0000 90493.53 90493.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.75 81.46% 9214.55 8921 10228 9211.45 0 10021 62167 62167 0.00
crit 1.54 18.54% 18447.97 17842 20456 14570.15 0 20456 28327 28327 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 129 0.3% 8.3 33.18sec 4690 0 Direct 8.3 3949 7904 4690 18.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.28 8.28 0.00 0.00 0.0000 0.0000 38844.61 38844.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.73 81.27% 3949.38 3823 4384 3946.96 0 4295 26581 26581 0.00
crit 1.55 18.73% 7903.65 7646 8767 6209.12 0 8767 12263 12263 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6175 15.3% 81.4 3.66sec 22792 17591 Direct 81.4 19204 38393 22791 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.43 81.43 0.00 0.00 1.2957 0.0000 1855998.99 1855998.99 0.00 17590.91 17590.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.21 81.30% 19203.69 10135 25236 19210.35 18595 20221 1271400 1271400 0.00
crit 15.23 18.70% 38392.98 20270 50471 38404.95 34964 43865 584599 584599 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3189 7.9% 14.3 21.13sec 67058 66429 Direct 14.3 3625 7258 4304 18.7%  
Periodic 224.6 3364 6725 3991 18.7% 99.2%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.28 14.28 224.58 224.58 1.0095 1.3289 957908.99 957908.99 0.00 3061.74 66429.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.62 81.33% 3625.33 3280 4661 3626.54 3344 4020 42117 42117 0.00
crit 2.67 18.67% 7257.75 6559 9322 6874.76 0 9322 19358 19358 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.7 81.33% 3363.88 13 4339 3365.33 3257 3507 614413 614413 0.00
crit 41.9 18.67% 6725.28 9 8679 6727.28 6330 7294 282021 282021 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 3347 (5433) 8.3% (13.5%) 96.1 3.07sec 16986 18884 Direct 96.7 8771 17538 10401 18.6%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.08 96.67 0.00 0.00 0.8995 0.0000 1005452.35 1005452.35 0.00 18883.65 18883.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.69 81.40% 8770.71 7949 11297 8775.93 8473 9246 690170 690170 0.00
crit 17.98 18.60% 17538.08 15898 22594 17543.03 16116 19421 315283 315283 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2085 5.2% 79.6 3.69sec 7867 0 Direct 79.6 7866 0 7866 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.65 79.65 0.00 0.00 0.0000 0.0000 626566.86 626566.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.65 100.00% 7866.38 5962 16945 7870.25 6939 9154 626567 626567 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7541.54
  • base_dd_max:7541.54
  • base_dd_mult:1.00
 
Starsurge 14846 36.8% 66.5 4.56sec 67077 64586 Direct 66.2 56731 113412 67315 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.46 66.23 0.00 0.00 1.0386 0.0000 4458005.82 4458005.82 0.00 64586.32 64586.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.86 81.33% 56730.56 51347 72557 56755.76 54266 59507 3055502 3055502 0.00
crit 12.37 18.67% 113412.04 102695 145115 113439.44 102695 132447 1402504 1402504 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 6156 15.2% 93.5 3.04sec 19675 0 Direct 93.5 16589 33188 19675 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.48 93.48 0.00 0.00 0.0000 0.0000 1839284.89 1839284.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.10 81.41% 16588.62 16021 18369 16587.63 16048 17554 1262435 1262435 0.00
crit 17.38 18.59% 33187.57 32042 36737 33188.18 32042 35992 576850 576850 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3225 8.0% 17.8 16.90sec 54449 53462 Direct 17.8 4551 9091 5399 18.7%  
Periodic 223.8 3285 6565 3899 18.7% 98.9%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.79 17.79 223.85 223.85 1.0185 1.3292 968775.93 968775.93 0.00 3069.01 53461.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.47 81.33% 4551.13 4112 5844 4552.58 4189 4911 65855 65855 0.00
crit 3.32 18.67% 9090.94 8225 11689 8812.29 0 11689 30205 30205 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.0 81.30% 3285.20 2 4237 3286.65 3189 3429 597855 597855 0.00
crit 41.9 18.70% 6565.32 46 8474 6567.56 6145 7118 274862 274862 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
lucid dreams
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.70sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.50sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8999 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.8 58.4 41.1sec 4.6sec 92.96% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.49%
  • arcanic_pulsar_2:11.44%
  • arcanic_pulsar_3:10.98%
  • arcanic_pulsar_4:11.07%
  • arcanic_pulsar_5:11.61%
  • arcanic_pulsar_6:11.80%
  • arcanic_pulsar_7:10.89%
  • arcanic_pulsar_8:13.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.1sec 0.0sec 16.17% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.09% 7.59% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.48% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 7.9 0.0 40.3sec 40.3sec 27.06% 36.81% 0.0(0.0) 7.7

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:27.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.5sec 23.60% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.4 0.0 60.8sec 60.8sec 14.13% 0.00% 84.8(84.8) 5.2

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.22% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.84%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lucid Dreams 7.9 2.2 36.0sec 27.5sec 23.57% 0.00% 2.2(2.2) 7.6

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lucid_dreams
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:376.75

Stack Uptimes

  • lucid_dreams_1:23.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298343
  • name:Lucid Dreams
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc298339=When Lucid Dreams $?!a137020[refunds ][]$?a137028[part of a Shield of the Righteous charge]?a137019[part of a charge of Fire Blast]?a137020[generates an icicle][{$@spelldesc298373=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Runes]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]}], gain {$s1=0} Versatility for {$298343d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Lunar Empowerment 31.8 54.1 9.5sec 3.5sec 84.08% 99.89% 2.9(2.9) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:31.91%
  • lunar_empowerment_2:34.30%
  • lunar_empowerment_3:17.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.5sec 33.6sec 48.18% 0.00% 3.5(49.3) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.73%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.24%
  • overwhelming_power_19:2.31%
  • overwhelming_power_20:2.38%
  • overwhelming_power_21:2.45%
  • overwhelming_power_22:2.53%
  • overwhelming_power_23:2.60%
  • overwhelming_power_24:2.68%
  • overwhelming_power_25:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 23.1 59.6 12.7sec 3.6sec 87.75% 82.54% 0.6(0.6) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:26.05%
  • solar_empowerment_2:41.10%
  • solar_empowerment_3:20.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.4 51.0 20.1sec 4.6sec 97.85% 93.06% 20.6(20.6) 11.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.72%
  • starlord_2:21.76%
  • starlord_3:61.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.1sec 45.5sec 23.62% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.62%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
lucid dreams
starsurge Astral Power 66.5 2658.4 40.0 40.0 1676.9
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 97.09 775.48 (29.56%) 7.99 1.23 0.16%
celestial_alignment Astral Power 2.00 80.00 (3.05%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.82 211.93 (8.08%) 2.50 0.13 0.06%
sunfire Astral Power 17.79 53.38 (2.03%) 3.00 0.00 0.00%
moonfire Astral Power 14.28 42.85 (1.63%) 3.00 0.00 0.00%
lunar_strike Astral Power 81.43 975.23 (37.18%) 11.98 1.94 0.20%
lucid_dreams Astral Power 10.04 200.78 (7.65%) 20.00 0.00 0.00%
natures_balance Astral Power 401.52 200.73 (7.65%) 0.50 0.03 0.02%
arcanic_pulsar Astral Power 6.91 82.93 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.72 8.84
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 22.19 0.00 91.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data lucid dreams Fight Length
Count 3985
Mean 300.77
Minimum 240.06
Maximum 359.83
Spread ( max - min ) 119.77
Range [ ( max - min ) / 2 * 100% ] 19.91%
DPS
Sample Data lucid dreams Damage Per Second
Count 3985
Mean 40351.84
Minimum 36541.79
Maximum 45639.73
Spread ( max - min ) 9097.94
Range [ ( max - min ) / 2 * 100% ] 11.27%
Standard Deviation 1298.5866
5th Percentile 38318.73
95th Percentile 42561.02
( 95th Percentile - 5th Percentile ) 4242.29
Mean Distribution
Standard Deviation 20.5711
95.00% Confidence Intervall ( 40311.53 - 40392.16 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3979
0.1 Scale Factor Error with Delta=300 14396
0.05 Scale Factor Error with Delta=300 57582
0.01 Scale Factor Error with Delta=300 1439546
Priority Target DPS
Sample Data lucid dreams Priority Target Damage Per Second
Count 3985
Mean 40351.84
Minimum 36541.79
Maximum 45639.73
Spread ( max - min ) 9097.94
Range [ ( max - min ) / 2 * 100% ] 11.27%
Standard Deviation 1298.5866
5th Percentile 38318.73
95th Percentile 42561.02
( 95th Percentile - 5th Percentile ) 4242.29
Mean Distribution
Standard Deviation 20.5711
95.00% Confidence Intervall ( 40311.53 - 40392.16 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3979
0.1 Scale Factor Error with Delta=300 14396
0.05 Scale Factor Error with Delta=300 57582
0.01 Scale Factor Error with Delta=300 1439546
DPS(e)
Sample Data lucid dreams Damage Per Second (Effective)
Count 3985
Mean 40351.84
Minimum 36541.79
Maximum 45639.73
Spread ( max - min ) 9097.94
Range [ ( max - min ) / 2 * 100% ] 11.27%
Damage
Sample Data lucid dreams Damage
Count 3985
Mean 12110550.54
Minimum 9327371.12
Maximum 14804929.67
Spread ( max - min ) 5477558.55
Range [ ( max - min ) / 2 * 100% ] 22.61%
DTPS
Sample Data lucid dreams Damage Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data lucid dreams Healing Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data lucid dreams Healing Per Second (Effective)
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data lucid dreams Heal
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data lucid dreams Healing Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data lucid dreams Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data lucid dreamsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data lucid dreams Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.37 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 3.42 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 66.46 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.00 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.50 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.48 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.79 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 81.75 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 96.31 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.32 sunfire

Sample Sequence

012345678ACDKKONPPQHFGIKQKQPQKQPQKNQOJKQPKQPQKQPQPKQPKQPKNPQPPQKOPQKQPPKQPNQQPQQQKKOPKQIQKQPNPKQPQPQKQOPKNQPKQPKQPPQPKKQNOPQKQPQKQLPPPQPKKQGIOPKQPKNQPPPKQPQKPKQPKOQPQKQLPKPPPQKKQPPNKOQPQQKPQQQQKPPHEFIKNOQKQPKQPQKQPQPKNQPKQPKMPPKQPPNQPKQKQPKQPKQPMPKNQPPGQKQPIQPKQPKONQPKQPPQQKPKQPPKQKQPQPKNOPQQKPQPKPNQQQKPOQQQQQKPIKNPKQPQQQQOPJKQKQKQLPP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask lucid dreams 58.0/100: 58% astral_power
Pre precombat 1 food lucid dreams 58.0/100: 58% astral_power
Pre precombat 2 augmentation lucid dreams 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, lucid_dreams, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.165 default O moonfire Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), battle_potion_of_intellect
0:02.991 default N sunfire Fluffy_Pillow 10.5/100: 11% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), battle_potion_of_intellect
0:03.816 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), battle_potion_of_intellect
0:04.871 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), battle_potion_of_intellect
0:05.929 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), solar_empowerment(3), starlord(2), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
0:06.686 default H celestial_alignment Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect
0:07.440 default F berserking Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
0:07.440 default G use_items Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
0:07.440 default I fury_of_elune Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(2), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:08.195 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, solar_empowerment(2), starlord(2), overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:08.950 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:09.706 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:10.459 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:11.214 default P lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:12.014 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.769 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.524 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.278 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.057 default Q solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.811 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(11), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.566 default N sunfire Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.320 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.074 default O moonfire Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(8), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.827 default J cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(8), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.827 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, berserking, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, overwhelming_power(8), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.581 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.335 default P lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.147 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.901 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.657 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.452 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20), ignition_mages_fuse(5)
0:24.206 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(19), ignition_mages_fuse(5)
0:24.960 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), ignition_mages_fuse(5)
0:25.714 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18), ignition_mages_fuse(5)
0:26.469 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(5)
0:27.225 default P lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(5)
0:27.981 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers
0:28.736 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers
0:29.489 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(14), conch_of_dark_whispers
0:30.412 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13), conch_of_dark_whispers
0:31.168 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers
0:31.923 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers
0:32.851 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(11), conch_of_dark_whispers
0:33.691 default N sunfire Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
0:34.536 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers
0:35.615 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(8), conch_of_dark_whispers
0:36.370 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers
0:37.457 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6), conch_of_dark_whispers
0:38.547 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5), conch_of_dark_whispers
0:39.302 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar(3), solar_empowerment, torrent_of_elements, overwhelming_power(4), conch_of_dark_whispers
0:40.242 default O moonfire Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(3), conch_of_dark_whispers
0:41.156 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(2), conch_of_dark_whispers
0:42.676 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power
0:43.695 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
0:44.897 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:45.890 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:47.380 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:48.867 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:50.035 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:51.003 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:52.448 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:53.585 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:54.552 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), conch_of_dark_whispers
0:55.520 default P lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), conch_of_dark_whispers
0:56.965 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(6), starlord(3), conch_of_dark_whispers
0:58.102 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(6), starlord(3), conch_of_dark_whispers
0:59.239 default Q solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(6), starlord(3), conch_of_dark_whispers
1:00.376 default K starsurge Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(6)
1:01.616 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
1:02.818 default O moonfire Fluffy_Pillow 28.5/100: 28% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:03.987 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:05.475 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
1:06.645 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:07.485 default I fury_of_elune Fluffy_Pillow 26.5/100: 27% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:08.475 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power lucid_dreams, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:09.313 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power lucid_dreams, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3)
1:10.301 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:11.142 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3)
1:12.401 default N sunfire Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:13.537 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:14.985 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3)
1:16.118 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:17.086 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:18.532 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:19.500 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:20.947 default Q solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), conch_of_dark_whispers
1:22.000 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), conch_of_dark_whispers
1:23.238 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord, conch_of_dark_whispers
1:24.260 default O moonfire Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, conch_of_dark_whispers
1:25.464 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, conch_of_dark_whispers
1:26.996 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
1:28.199 default N sunfire Fluffy_Pillow 54.5/100: 55% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers
1:29.367 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers
1:30.360 default P lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:31.848 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:33.018 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:33.984 default P lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:35.431 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
1:36.567 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:37.535 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:38.979 default P lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
1:40.428 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
1:41.394 default P lunar_strike Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3)
1:42.843 default K starsurge Fluffy_Pillow 99.5/100: 100% astral_power arcanic_pulsar(6), solar_empowerment
1:44.083 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord
1:45.285 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:46.277 default N sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:47.444 default O moonfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:48.612 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:50.101 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2)
1:51.094 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
1:52.261 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:53.103 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:54.360 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:55.199 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
1:56.187 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24)
1:56.957 default L sunfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24)
1:57.864 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23)
1:59.194 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21)
2:00.536 default P lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20)
2:01.884 default Q solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(19)
2:02.786 default P lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18)
2:04.143 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar, solar_empowerment, overwhelming_power(16)
2:05.310 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(15)
2:06.448 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(14)
2:07.394 default G use_items Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13)
2:07.394 default I fury_of_elune Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), ignition_mages_fuse
2:08.554 default O moonfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), ignition_mages_fuse
2:09.626 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(3), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11), ignition_mages_fuse
2:10.997 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(3), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(10), ignition_mages_fuse
2:12.078 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power lucid_dreams, arcanic_pulsar(4), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(8), ignition_mages_fuse(2)
2:12.943 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power lucid_dreams, arcanic_pulsar(4), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8), ignition_mages_fuse(2)
2:14.238 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power lucid_dreams, arcanic_pulsar(4), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6), ignition_mages_fuse(2)
2:15.261 default N sunfire Fluffy_Pillow 42.5/100: 43% astral_power lucid_dreams, arcanic_pulsar(5), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(5), ignition_mages_fuse(2)
2:16.286 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(4), ignition_mages_fuse(3)
2:17.129 default P lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(3), ignition_mages_fuse(3)
2:18.394 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2), ignition_mages_fuse(3)
2:19.664 default P lunar_strike Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, ignition_mages_fuse(4)
2:20.891 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
2:21.859 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse(4)
2:22.682 default P lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
2:23.914 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
2:24.707 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, ignition_mages_fuse(5)
2:25.721 default P lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, ignition_mages_fuse(5)
2:26.974 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, ignition_mages_fuse(5)
2:27.959 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(25)
2:28.868 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24)
2:30.234 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24)
2:31.306 default O moonfire Fluffy_Pillow 34.5/100: 35% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23)
2:32.217 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22)
2:32.994 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22)
2:34.156 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20)
2:34.940 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20)
2:35.861 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19)
2:36.648 default L sunfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18)
2:37.576 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17)
2:38.938 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16)
2:40.011 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14)
2:41.385 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13)
2:42.765 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers
2:44.150 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
2:45.081 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(2), solar_empowerment, torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers
2:46.280 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers
2:47.447 default Q solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers
2:48.417 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers
2:49.873 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5), conch_of_dark_whispers
2:51.333 default N sunfire Fluffy_Pillow 38.0/100: 38% astral_power lucid_dreams, arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(3), conch_of_dark_whispers
2:52.489 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power lucid_dreams, arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(2), conch_of_dark_whispers
2:53.648 default O moonfire Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power, conch_of_dark_whispers
2:54.779 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:55.746 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:57.193 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:58.159 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3)
2:59.124 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), starlord(3)
3:00.261 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3)
3:01.708 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
3:02.674 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(6), starlord(3)
3:03.810 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), starlord(3)
3:04.947 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), starlord(3)
3:06.084 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(6), lunar_empowerment
3:07.321 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord
3:08.853 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
3:10.387 default H celestial_alignment Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(7), celestial_alignment, solar_empowerment(2), starlord
3:11.433 default E potion Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(7), celestial_alignment, solar_empowerment(2), starlord
3:11.433 default F berserking Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(7), celestial_alignment, solar_empowerment(2), starlord, battle_potion_of_intellect
3:11.433 default I fury_of_elune Fluffy_Pillow 81.5/100: 82% astral_power berserking, arcanic_pulsar(7), celestial_alignment, solar_empowerment(2), starlord, battle_potion_of_intellect
3:12.383 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power berserking, arcanic_pulsar(7), celestial_alignment, fury_of_elune, solar_empowerment(2), starlord, battle_potion_of_intellect
3:13.335 default N sunfire Fluffy_Pillow 50.0/100: 50% astral_power berserking, arcanic_pulsar(8), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), battle_potion_of_intellect
3:14.261 default O moonfire Fluffy_Pillow 59.0/100: 59% astral_power berserking, arcanic_pulsar(8), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), battle_potion_of_intellect
3:15.185 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power berserking, arcanic_pulsar(8), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), battle_potion_of_intellect
3:15.971 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power berserking, arcanic_pulsar(8), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:16.896 default Q solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power berserking, lucid_dreams, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:17.661 default P lunar_strike Fluffy_Pillow 89.5/100: 90% astral_power berserking, lucid_dreams, celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:18.804 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power berserking, lucid_dreams, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:19.705 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power berserking, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:20.469 default P lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power berserking, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:21.613 default Q solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power berserking, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:22.377 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power berserking, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:23.276 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power berserking, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:24.041 default P lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:25.300 default Q solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect
3:26.141 default P lunar_strike Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), battle_potion_of_intellect
3:27.514 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), battle_potion_of_intellect
3:28.590 default N sunfire Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, battle_potion_of_intellect
3:29.635 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, battle_potion_of_intellect
3:30.523 default P lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord, battle_potion_of_intellect
3:31.857 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord, battle_potion_of_intellect
3:32.903 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), battle_potion_of_intellect
3:33.766 default P lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(2), battle_potion_of_intellect
3:35.062 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(2), battle_potion_of_intellect
3:36.077 default M moonfire Fluffy_Pillow 47.5/100: 48% astral_power lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:37.066 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment, starlord(3)
3:38.513 default P lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:39.960 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
3:41.096 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:42.065 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:43.513 default P lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
3:44.961 default N sunfire Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
3:46.097 default Q solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
3:47.062 default P lunar_strike Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3)
3:48.508 default K starsurge Fluffy_Pillow 97.5/100: 98% astral_power arcanic_pulsar(6), solar_empowerment(2)
3:49.746 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord
3:50.769 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord
3:51.971 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2)
3:52.965 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:54.453 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25)
3:55.520 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24)
3:56.292 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23)
3:57.449 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
3:58.362 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21)
3:59.142 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20)
4:00.312 default M moonfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19)
4:01.236 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18)
4:02.594 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(17)
4:03.662 default N sunfire Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(25)
4:04.705 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(24)
4:05.591 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23)
4:06.923 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
4:08.262 default G use_items Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), overwhelming_power(20)
4:08.262 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), overwhelming_power(20), ignition_mages_fuse
4:09.126 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), overwhelming_power(19), ignition_mages_fuse
4:10.238 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(18), ignition_mages_fuse
4:11.157 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(17), ignition_mages_fuse
4:12.539 default I fury_of_elune Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(16), ignition_mages_fuse(2)
4:13.587 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(15), ignition_mages_fuse(2)
4:14.482 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(14), ignition_mages_fuse(2)
4:15.825 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(3), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(13), ignition_mages_fuse(2)
4:16.883 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(4), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(12), ignition_mages_fuse(3)
4:17.727 default P lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11), ignition_mages_fuse(3)
4:18.993 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(4), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(10), ignition_mages_fuse(3)
4:19.992 default O moonfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(9), ignition_mages_fuse(3)
4:20.967 default N sunfire Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(8), ignition_mages_fuse(4)
4:21.910 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(25), ignition_mages_fuse(4)
4:22.672 default P lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), ignition_mages_fuse(4)
4:23.816 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), ignition_mages_fuse(4)
4:24.717 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22), ignition_mages_fuse(5)
4:25.472 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), ignition_mages_fuse(5)
4:26.585 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), ignition_mages_fuse(5)
4:27.701 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(19), ignition_mages_fuse(5)
4:28.455 default Q solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(18)
4:29.361 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, overwhelming_power(17)
4:30.526 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(16)
4:31.972 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(15)
4:33.109 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(24)
4:34.022 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23)
4:35.392 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22)
4:36.765 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(21)
4:37.850 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power lucid_dreams, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20)
4:38.633 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power lucid_dreams, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19)
4:39.556 default Q solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18)
4:40.342 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17)
4:41.525 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16)
4:42.318 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15)
4:43.509 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power lucid_dreams, arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(14)
4:44.587 default N sunfire Fluffy_Pillow 11.0/100: 11% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13)
4:45.671 default O moonfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12)
4:46.761 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11)
4:48.152 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9)
4:49.085 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8)
4:50.021 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(2), torrent_of_elements, overwhelming_power(7)
4:51.226 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(6)
4:52.724 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(25)
4:53.658 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, starlord, torrent_of_elements, overwhelming_power(24)
4:55.064 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), starlord, torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
4:56.175 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
4:57.557 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
4:58.643 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(25), conch_of_dark_whispers
4:59.551 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), starlord(2), overwhelming_power(24), conch_of_dark_whispers
5:00.623 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), starlord(2), overwhelming_power(23), conch_of_dark_whispers
5:01.699 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(4), starlord(2), overwhelming_power(22), conch_of_dark_whispers
5:02.776 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers
5:04.118 default O moonfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers
5:05.180 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(18), conch_of_dark_whispers
5:06.085 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(17), conch_of_dark_whispers
5:07.154 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(16), conch_of_dark_whispers
5:08.227 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(15), conch_of_dark_whispers
5:09.305 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(14), conch_of_dark_whispers
5:10.384 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(5), overwhelming_power(13)
5:11.565 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12)
5:13.031 default I fury_of_elune Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), solar_empowerment, starlord, overwhelming_power(10)
5:14.192 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment, starlord, overwhelming_power(9)
5:15.356 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(8)
5:16.491 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7)
5:17.941 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), overwhelming_power(6)
5:19.083 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(4)
5:20.032 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3)
5:21.463 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(2)
5:22.423 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power
5:23.385 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), starlord(3)
5:24.522 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(8), starlord(3)
5:25.659 default O moonfire Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3)
5:26.795 default P lunar_strike Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3)
5:28.243 default J cancel_buff Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(8), starlord(3)
5:28.243 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(8)
5:29.481 default Q solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
5:30.372 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power celestial_alignment, lunar_empowerment, starlord
5:31.419 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
5:32.282 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements
5:33.299 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
5:34.139 default L sunfire Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements
5:35.126 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), torrent_of_elements
5:36.573 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), torrent_of_elements

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="lucid dreams"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

purification protocol : 39419 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
39419.0 39419.0 36.7 / 0.093% 4597.7 / 11.7% 4772.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.2 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
purification protocol 39419
Fury of Elune 885 2.2% 5.4 60.74sec 49339 49980 Direct 133.4 1680 3356 1989 18.4%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 133.40 143.57 0.00 0.9873 0.2959 265343.04 265343.04 0.00 5552.39 49979.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 108.82 81.57% 1680.25 1457 1987 1681.68 1596 1836 182842 182842 0.00
crit 24.58 18.43% 3356.10 2915 3974 3358.37 3035 3854 82501 82501 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 298 (425) 0.8% (1.1%) 8.3 33.54sec 15495 0 Direct 8.3 9128 18267 10839 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.26 8.26 0.00 0.00 0.0000 0.0000 89507.74 89507.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.71 81.28% 9127.55 8921 9813 9128.57 8921 9813 61266 61266 0.00
crit 1.55 18.72% 18266.63 17842 19626 14522.02 0 19626 28242 28242 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 128 0.3% 8.3 33.54sec 4656 0 Direct 8.3 3912 7829 4656 19.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.26 8.26 0.00 0.00 0.0000 0.0000 38452.56 38452.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 80.99% 3911.80 3823 4206 3912.59 3823 4206 26165 26165 0.00
crit 1.57 19.01% 7828.50 7646 8411 6246.22 0 8411 12288 12288 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5979 15.2% 79.6 3.74sec 22560 17347 Direct 79.6 19020 38038 22560 18.6%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.65 79.65 0.00 0.00 1.3005 0.0000 1796862.10 1796862.10 0.00 17346.91 17346.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.82 81.38% 19019.51 10135 24211 19026.51 18341 19995 1232815 1232815 0.00
crit 14.83 18.62% 38037.74 20270 48422 38055.99 34451 43625 564047 564047 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3146 8.0% 14.1 21.39sec 67007 66788 Direct 14.1 3610 7224 4288 18.8%  
Periodic 224.2 3324 6646 3945 18.7% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.10 14.10 224.19 224.19 1.0033 1.3318 944851.75 944851.75 0.00 3021.26 66788.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.46 81.24% 3609.93 3280 4472 3612.89 3354 4081 41352 41352 0.00
crit 2.65 18.76% 7224.07 6559 8943 6821.06 0 8943 19113 19113 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.3 81.33% 3324.47 8 4163 3325.96 3239 3472 606158 606158 0.00
crit 41.9 18.67% 6646.33 34 8327 6649.43 6289 7151 278228 278228 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Purification Protocol 743 1.9% 16.7 17.31sec 13334 0 Direct 16.7 11226 22454 13333 18.8%  

Stats details: purification_protocol

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.74 16.74 0.00 0.00 0.0000 0.0000 223271.04 223271.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.60 81.23% 11226.43 10972 12069 11225.63 10972 11913 152703 152703 0.00
crit 3.14 18.77% 22453.84 21944 24139 21584.76 0 24139 70568 70568 0.00
 
 

Action details: purification_protocol

Static Values
  • id:295293
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295293
  • name:Purification Protocol
  • school:physical
  • tooltip:
  • description:MOTHER has added a Purification Protocol to your Heart of Azeroth, allowing your damaging spells and abilities to release a blast of Azerite energy at your target, dealing ${{$s1=1920}*(1+$@versadmg)} Fire damage to any enemy within $295305A2 yds$?a295363[, and heals you for ${{$295293s4=869}*(1+$@versadmg)} every $295310t1 sec for {$295310d=8 seconds}][]. Purification Protocol deals {$s2=50}% additional damage against Aberrations.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9969.52
  • base_dd_max:9969.52
  • base_dd_mult:1.00
 
Solar Wrath 3485 (5446) 8.9% (13.8%) 101.6 2.90sec 16097 17623 Direct 102.1 8653 17296 10253 18.5%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.64 102.13 0.00 0.00 0.9134 0.0000 1047127.99 1047127.99 0.00 17623.43 17623.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.23 81.49% 8652.76 7949 10838 8657.17 8387 9036 720133 720133 0.00
crit 18.91 18.51% 17295.99 15898 21676 17306.28 16057 18942 326995 326995 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1961 5.0% 75.8 3.87sec 7771 0 Direct 75.8 7771 0 7771 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.79 75.79 0.00 0.00 0.0000 0.0000 589013.50 589013.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.79 100.00% 7771.10 5962 16257 7775.07 6837 8881 589014 589014 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6557.86
  • base_dd_max:6557.86
  • base_dd_mult:1.00
 
Starsurge 13683 34.7% 62.0 4.88sec 66302 63671 Direct 61.8 56142 112197 66515 18.5%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.98 61.78 0.00 0.00 1.0413 0.0000 4109372.06 4109372.06 0.00 63670.72 63670.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.34 81.49% 56142.38 51347 69612 56166.13 54436 59324 2826275 2826275 0.00
crit 11.44 18.51% 112197.39 102695 139223 112241.36 102695 126927 1283097 1283097 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 5925 15.0% 91.1 3.08sec 19427 0 Direct 91.1 16389 32773 19426 18.5%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.13 91.13 0.00 0.00 0.0000 0.0000 1770373.97 1770373.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.23 81.46% 16388.69 16021 17623 16388.46 16021 17212 1216556 1216556 0.00
crit 16.90 18.54% 32772.67 32042 35246 32772.55 32042 34890 553818 553818 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3186 8.1% 18.0 16.72sec 53310 52360 Direct 18.0 4509 9027 5357 18.8%  
Periodic 223.5 3247 6489 3852 18.7% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.95 17.95 223.47 223.47 1.0182 1.3322 956927.13 956927.13 0.00 3028.48 52359.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.58 81.23% 4508.52 4112 5607 4509.30 4220 4905 65736 65736 0.00
crit 3.37 18.77% 9026.99 8225 11214 8788.70 0 11214 30421 30421 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.8 81.34% 3247.06 15 4065 3248.51 3164 3380 590232 590232 0.00
crit 41.7 18.66% 6488.62 4 8130 6491.35 6107 6927 270538 270538 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
purification protocol
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.55sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.34sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9064 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.5 43.9sec 4.9sec 92.63% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:12.27%
  • arcanic_pulsar_2:10.21%
  • arcanic_pulsar_3:11.09%
  • arcanic_pulsar_4:10.63%
  • arcanic_pulsar_5:13.05%
  • arcanic_pulsar_6:11.56%
  • arcanic_pulsar_7:11.14%
  • arcanic_pulsar_8:12.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.6sec 0.0sec 16.17% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.09% 7.48% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.48% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.9sec 37.9sec 25.97% 35.88% 0.0(0.0) 8.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.2sec 45.8sec 23.53% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.4 0.0 60.8sec 60.8sec 14.14% 0.00% 84.9(84.9) 5.2

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.24% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.80%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 40.8 41.7 7.5sec 3.6sec 77.86% 99.77% 1.8(1.8) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:38.58%
  • lunar_empowerment_2:26.07%
  • lunar_empowerment_3:13.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.5 64.8sec 33.9sec 47.80% 0.00% 3.5(48.6) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.22%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.58%
  • overwhelming_power_24:2.65%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 29.4 48.5 10.3sec 3.9sec 82.42% 74.33% 0.1(0.1) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:33.64%
  • solar_empowerment_2:35.96%
  • solar_empowerment_3:12.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.7 20.3sec 4.9sec 97.64% 92.86% 16.5(16.5) 12.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.69%
  • starlord_2:22.32%
  • starlord_3:59.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.0sec 45.6sec 23.73% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
purification protocol
starsurge Astral Power 62.0 2479.1 40.0 40.0 1657.6
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 102.64 820.77 (33.61%) 8.00 0.39 0.05%
celestial_alignment Astral Power 2.00 80.00 (3.28%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.93 212.33 (8.70%) 2.50 0.01 0.00%
sunfire Astral Power 17.95 53.85 (2.21%) 3.00 0.00 0.00%
moonfire Astral Power 14.10 42.30 (1.73%) 3.00 0.00 0.00%
lunar_strike Astral Power 79.64 955.41 (39.13%) 12.00 0.33 0.03%
natures_balance Astral Power 401.52 200.75 (8.22%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.37 76.40 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.12 8.24
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.67 0.00 79.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data purification protocol Fight Length
Count 3985
Mean 300.77
Minimum 240.06
Maximum 359.83
Spread ( max - min ) 119.77
Range [ ( max - min ) / 2 * 100% ] 19.91%
DPS
Sample Data purification protocol Damage Per Second
Count 3985
Mean 39419.04
Minimum 34970.76
Maximum 43832.30
Spread ( max - min ) 8861.54
Range [ ( max - min ) / 2 * 100% ] 11.24%
Standard Deviation 1183.5906
5th Percentile 37583.25
95th Percentile 41423.32
( 95th Percentile - 5th Percentile ) 3840.08
Mean Distribution
Standard Deviation 18.7494
95.00% Confidence Intervall ( 39382.29 - 39455.79 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3464
0.1 Scale Factor Error with Delta=300 11959
0.05 Scale Factor Error with Delta=300 47836
0.01 Scale Factor Error with Delta=300 1195878
Priority Target DPS
Sample Data purification protocol Priority Target Damage Per Second
Count 3985
Mean 39419.04
Minimum 34970.76
Maximum 43832.30
Spread ( max - min ) 8861.54
Range [ ( max - min ) / 2 * 100% ] 11.24%
Standard Deviation 1183.5906
5th Percentile 37583.25
95th Percentile 41423.32
( 95th Percentile - 5th Percentile ) 3840.08
Mean Distribution
Standard Deviation 18.7494
95.00% Confidence Intervall ( 39382.29 - 39455.79 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3464
0.1 Scale Factor Error with Delta=300 11959
0.05 Scale Factor Error with Delta=300 47836
0.01 Scale Factor Error with Delta=300 1195878
DPS(e)
Sample Data purification protocol Damage Per Second (Effective)
Count 3985
Mean 39419.04
Minimum 34970.76
Maximum 43832.30
Spread ( max - min ) 8861.54
Range [ ( max - min ) / 2 * 100% ] 11.24%
Damage
Sample Data purification protocol Damage
Count 3985
Mean 11831102.89
Minimum 9081126.41
Maximum 14453852.73
Spread ( max - min ) 5372726.31
Range [ ( max - min ) / 2 * 100% ] 22.71%
DTPS
Sample Data purification protocol Damage Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data purification protocol Healing Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data purification protocol Healing Per Second (Effective)
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data purification protocol Heal
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data purification protocol Healing Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data purification protocol Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data purification protocolTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data purification protocol Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.38 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.35 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.98 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.04 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.87 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.75 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.23 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 80.00 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 101.90 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.16 sunfire

Sample Sequence

012345678ACDKONPHFGIKQKQPKQPQKQPKNQOQPQKQPQKLPPPKQPKQPQPKPQQPOQKPNQKPPQKPQPQQQQPKKNOIPPKQPQQPQJKNKQKQMPPKPPQQPQNQKKPQPOKQPPPKQNPQQKPPKGQIQPKQMPKNQPPPQKKQPPKQPQOKNQPQQQQQKPKPQPQKNQPKQMPPPQKPQHEFKIKNQKQPQKOQPQPQPKQPKNPPQKQPKQPMQPQPQKNQPKQPKQPQKQOPPNQKQPGKIQPKQPPQQQQKNQPJKQKMPKPQPQKQPPNQQQOKPKQPQQKPQNQKPQQQOKQPIKQLPKPKPPQQQPQKOPKNQPQKQP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask purification protocol 58.0/100: 58% astral_power
Pre precombat 1 food purification protocol 58.0/100: 58% astral_power
Pre precombat 2 augmentation purification protocol 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.236 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.160 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.084 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.262 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.070 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.070 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.070 default I fury_of_elune Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.825 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.580 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.333 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.088 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse
0:08.842 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse
0:09.621 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.373 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.128 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.883 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.637 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.392 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.146 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.901 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.656 default N sunfire Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.411 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.165 default O moonfire Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.920 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.675 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.449 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.203 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.957 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.710 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.508 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.263 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(16), ignition_mages_fuse(5)
0:24.017 default L sunfire Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(15), ignition_mages_fuse(5)
0:24.771 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(15), ignition_mages_fuse(5)
0:25.668 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
0:26.754 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers
0:27.847 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers
0:28.707 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers
0:29.460 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
0:30.394 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
0:31.149 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
0:31.904 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
0:32.796 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
0:33.552 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
0:34.607 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
0:35.418 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
0:36.457 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
0:37.212 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
0:38.033 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
0:39.081 default O moonfire Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers
0:39.906 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers
0:40.731 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar(2), torrent_of_elements, overwhelming_power(15)
0:41.634 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(14)
0:43.089 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(12)
0:44.241 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(11)
0:45.225 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(10)
0:46.383 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(9)
0:47.823 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(8)
0:49.266 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(6)
0:50.237 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(5)
0:51.383 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4)
0:52.810 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(3)
0:53.766 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(2)
0:55.205 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3)
0:56.171 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), starlord(3)
0:57.308 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(5), starlord(3)
0:58.445 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(5), starlord(3)
0:59.583 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3)
1:01.032 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(5)
1:02.269 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
1:03.472 default N sunfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:04.640 default O moonfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:05.810 default I fury_of_elune Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:06.978 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:08.466 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2)
1:09.955 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2)
1:11.125 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3)
1:12.090 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3)
1:13.536 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(3)
1:14.503 default Q solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
1:15.469 default P lunar_strike Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3)
1:16.917 default Q solar_wrath Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(8), starlord(3)
1:18.053 default J cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(8), starlord(3)
1:18.053 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(8)
1:19.292 default N sunfire Fluffy_Pillow 72.5/100: 73% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
1:20.337 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
1:21.383 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:22.248 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
1:23.264 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:24.104 default M moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
1:25.093 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3)
1:26.541 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3)
1:27.987 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3)
1:29.125 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:30.574 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:32.022 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:32.988 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), conch_of_dark_whispers
1:33.954 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), conch_of_dark_whispers
1:35.401 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(3), starlord(3), conch_of_dark_whispers
1:36.536 default N sunfire Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:37.672 default Q solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:38.809 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(3), lunar_empowerment, torrent_of_elements, conch_of_dark_whispers
1:40.048 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
1:41.251 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:42.741 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:43.736 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:45.225 default O moonfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:46.395 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:47.563 default Q solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:48.529 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:49.976 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:51.424 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:52.871 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:54.007 default Q solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:54.973 default N sunfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:56.108 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:57.556 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), torrent_of_elements
1:58.523 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements
1:59.490 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, torrent_of_elements
2:00.729 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements
2:02.260 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
2:03.791 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, torrent_of_elements
2:04.993 default G use_items Fluffy_Pillow 14.0/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
2:04.993 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, ignition_mages_fuse
2:05.821 default I fury_of_elune Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse
2:06.796 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(25), ignition_mages_fuse
2:07.555 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(24), ignition_mages_fuse
2:08.697 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power celestial_alignment, fury_of_elune, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24), ignition_mages_fuse
2:09.594 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(23), ignition_mages_fuse(2)
2:10.349 default M moonfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), ignition_mages_fuse(2)
2:11.193 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), ignition_mages_fuse(2)
2:12.434 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), ignition_mages_fuse(2)
2:13.411 default N sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19), ignition_mages_fuse(3)
2:14.355 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18), ignition_mages_fuse(3)
2:15.161 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), ignition_mages_fuse(3)
2:16.371 default P lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), ignition_mages_fuse(3)
2:17.583 default P lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), ignition_mages_fuse(4)
2:18.758 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(14), ignition_mages_fuse(4)
2:19.546 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(2), solar_empowerment, overwhelming_power(13), ignition_mages_fuse(4)
2:20.558 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(12), ignition_mages_fuse(4)
2:21.542 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(11), ignition_mages_fuse(5)
2:22.330 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10), ignition_mages_fuse(5)
2:23.512 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.699 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(8), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.634 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(7), conch_of_dark_whispers
2:26.573 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6), conch_of_dark_whispers
2:27.988 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(5), conch_of_dark_whispers
2:28.936 default O moonfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(4), conch_of_dark_whispers
2:30.056 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers
2:31.185 default N sunfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power, conch_of_dark_whispers
2:32.316 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:33.280 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers
2:34.607 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers
2:35.496 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers
2:36.390 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(21), conch_of_dark_whispers
2:37.444 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(20), conch_of_dark_whispers
2:38.501 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(19), conch_of_dark_whispers
2:39.563 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(6), overwhelming_power(18), conch_of_dark_whispers
2:40.724 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17), conch_of_dark_whispers
2:42.163 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), solar_empowerment, starlord, overwhelming_power(15), conch_of_dark_whispers
2:43.302 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14), conch_of_dark_whispers
2:44.716 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), overwhelming_power(13)
2:45.663 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(12)
2:47.088 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(10)
2:48.045 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(9)
2:49.176 default N sunfire Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8)
2:50.136 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7)
2:50.956 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(7)
2:52.183 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5)
2:53.154 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4)
2:53.981 default M moonfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(4)
2:54.956 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(3)
2:56.388 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power
2:57.831 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3)
2:59.279 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, solar_empowerment, starlord(3)
3:00.246 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar
3:01.483 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord
3:03.015 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(2), solar_empowerment, starlord
3:04.037 default H celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(2), starlord, torrent_of_elements
3:05.308 default E potion Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(2), celestial_alignment, starlord, torrent_of_elements
3:05.308 default F berserking Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(2), celestial_alignment, starlord, torrent_of_elements, battle_potion_of_intellect
3:05.308 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power berserking, arcanic_pulsar(2), celestial_alignment, starlord, torrent_of_elements, battle_potion_of_intellect
3:06.260 default I fury_of_elune Fluffy_Pillow 49.0/100: 49% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, battle_potion_of_intellect
3:07.185 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, battle_potion_of_intellect
3:08.111 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:09.011 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:09.776 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:10.675 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:11.439 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:12.584 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:13.349 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), battle_potion_of_intellect
3:14.172 default O moonfire Fluffy_Pillow 10.5/100: 11% astral_power berserking, arcanic_pulsar(6), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect
3:14.995 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect
3:15.750 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect
3:16.804 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect
3:17.633 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect
3:18.801 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect
3:19.721 default P lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19), battle_potion_of_intellect
3:20.896 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, overwhelming_power(18), battle_potion_of_intellect
3:21.906 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(17), battle_potion_of_intellect
3:22.744 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(16), battle_potion_of_intellect
3:24.002 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(14), battle_potion_of_intellect
3:24.996 default N sunfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(14), battle_potion_of_intellect
3:26.106 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(12), battle_potion_of_intellect
3:27.531 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11), battle_potion_of_intellect
3:28.959 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(10), battle_potion_of_intellect
3:29.916 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9), battle_potion_of_intellect
3:31.047 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7)
3:31.866 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25)
3:33.017 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
3:33.923 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24)
3:34.696 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23)
3:35.854 default M moonfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22)
3:36.767 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21)
3:37.662 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20)
3:39.009 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18)
3:39.915 default P lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18)
3:41.272 default Q solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), overwhelming_power(16)
3:42.266 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), overwhelming_power(15)
3:43.439 default N sunfire Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(14)
3:44.580 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(13)
3:45.554 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(12)
3:47.018 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(10)
3:48.177 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(9)
3:49.138 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24)
3:50.503 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25)
3:51.571 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24)
3:52.459 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23)
3:53.791 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22)
3:54.684 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
3:55.739 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20)
3:56.639 default O moonfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19)
3:57.700 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18)
3:59.059 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16)
4:00.426 default N sunfire Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(24)
4:01.468 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(23)
4:02.357 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(5), solar_empowerment(2), overwhelming_power(22)
4:03.503 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(21)
4:04.449 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(20)
4:05.874 default G use_items Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, overwhelming_power(19)
4:05.874 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, overwhelming_power(19), ignition_mages_fuse
4:06.950 default I fury_of_elune Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(18), ignition_mages_fuse
4:08.003 default Q solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(16), ignition_mages_fuse
4:08.902 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16), ignition_mages_fuse
4:10.249 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14), ignition_mages_fuse(2)
4:11.274 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13), ignition_mages_fuse(2)
4:12.122 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12), ignition_mages_fuse(2)
4:13.401 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), ignition_mages_fuse(2)
4:14.682 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(10), ignition_mages_fuse(3)
4:15.507 default Q solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(9), ignition_mages_fuse(3)
4:16.335 default Q solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(8), ignition_mages_fuse(3)
4:17.311 default Q solar_wrath Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(7), ignition_mages_fuse(3)
4:18.290 default K starsurge Fluffy_Pillow 98.0/100: 98% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(6), ignition_mages_fuse(4)
4:19.238 default N sunfire Fluffy_Pillow 70.5/100: 71% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5), ignition_mages_fuse(4)
4:20.066 default Q solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(4), ignition_mages_fuse(4)
4:20.821 default P lunar_strike Fluffy_Pillow 82.5/100: 83% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(4), ignition_mages_fuse(4)
4:21.880 default J cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power celestial_alignment, starlord(3), overwhelming_power(3), ignition_mages_fuse(5)
4:21.880 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power celestial_alignment, overwhelming_power(3), ignition_mages_fuse(5)
4:22.754 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(2), conch_of_dark_whispers, ignition_mages_fuse(5)
4:23.510 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power, conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.365 default M moonfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.197 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.418 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers
4:27.586 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:29.033 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
4:30.000 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:31.447 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
4:32.413 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:33.550 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
4:34.517 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:35.963 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:37.411 default N sunfire Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:38.547 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3)
4:39.513 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3)
4:40.480 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(4), starlord(3)
4:41.616 default O moonfire Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(4), starlord(3)
4:42.753 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(4)
4:43.991 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord
4:45.524 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord
4:46.726 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2)
4:47.719 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2)
4:49.207 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2)
4:50.201 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2)
4:51.195 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), starlord(2)
4:52.363 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3)
4:53.810 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
4:54.774 default N sunfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), starlord(3)
4:55.912 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), starlord(3)
4:57.049 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), starlord(3)
4:58.187 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3)
4:59.634 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
5:00.600 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
5:01.566 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), starlord(3)
5:02.702 default O moonfire Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), starlord(3)
5:03.837 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8)
5:05.076 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
5:05.966 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power celestial_alignment, lunar_empowerment, starlord
5:07.299 default I fury_of_elune Fluffy_Pillow 40.5/100: 41% astral_power celestial_alignment, starlord
5:08.348 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power celestial_alignment, fury_of_elune, starlord
5:09.393 default Q solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2)
5:10.256 default L sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(2)
5:11.272 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), starlord(2)
5:12.759 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starlord(2)
5:13.928 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3)
5:15.375 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
5:16.510 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
5:17.958 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
5:19.282 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
5:20.172 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
5:21.066 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
5:21.963 default P lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
5:23.304 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
5:24.207 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
5:25.367 default O moonfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
5:26.497 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers
5:27.942 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers
5:29.081 default N sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers
5:30.195 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(12), conch_of_dark_whispers
5:31.147 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(11), conch_of_dark_whispers
5:32.578 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), overwhelming_power(10)
5:33.536 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(9)
5:34.667 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(8)
5:35.606 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="purification protocol"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

ripple in space : 40074 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
40073.6 40073.6 37.6 / 0.094% 4719.0 / 11.8% 4850.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.2 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ripple in space 40074
Fury of Elune 924 2.3% 5.4 60.76sec 51560 52291 Direct 133.6 1751 3495 2075 18.6%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 133.56 143.64 0.00 0.9861 0.2957 277144.71 277144.71 0.00 5800.80 52291.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 108.72 81.40% 1750.82 1457 2115 1752.37 1636 1952 190340 190340 0.00
crit 24.84 18.60% 3494.70 2915 4231 3497.96 3143 3988 86805 86805 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 297 (425) 0.7% (1.1%) 8.3 33.44sec 15471 0 Direct 8.3 9130 18246 10814 18.5%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.26 8.26 0.00 0.00 0.0000 0.0000 89291.94 89291.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.73 81.53% 9129.83 8921 9813 9124.47 0 9813 61458 61458 0.00
crit 1.53 18.47% 18246.25 17842 19626 14461.43 0 19626 27833 27833 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 128 0.3% 8.3 33.44sec 4658 0 Direct 8.3 3912 7827 4658 19.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.26 8.26 0.00 0.00 0.0000 0.0000 38458.89 38458.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.68 80.95% 3911.98 3823 4206 3911.60 3823 4206 26148 26148 0.00
crit 1.57 19.05% 7826.78 7646 8411 6245.08 0 8411 12310 12310 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6248 15.6% 79.7 3.74sec 23550 18111 Direct 79.7 19845 39687 23551 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.72 79.72 0.00 0.00 1.3003 0.0000 1877297.13 1877297.13 0.00 18111.36 18111.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.83 81.33% 19845.31 10135 25776 19853.44 19103 20837 1286610 1286610 0.00
crit 14.88 18.67% 39686.74 20270 51553 39689.04 36170 44284 590687 590687 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3282 8.2% 14.1 21.38sec 69936 69750 Direct 14.1 3768 7524 4471 18.7%  
Periodic 224.2 3470 6935 4115 18.6% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.10 14.10 224.22 224.22 1.0027 1.3316 985779.62 985779.62 0.00 3152.36 69750.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.46 81.28% 3767.65 3280 4761 3770.34 3445 4146 43164 43164 0.00
crit 2.64 18.72% 7524.01 6559 9522 7136.59 0 9522 19852 19852 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.4 81.37% 3469.77 9 4432 3471.35 3372 3655 633049 633049 0.00
crit 41.8 18.63% 6935.26 12 8865 6937.78 6510 7560 289714 289714 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 3641 (5695) 9.1% (14.2%) 101.6 2.90sec 16834 18434 Direct 102.1 9027 18042 10711 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.61 102.11 0.00 0.00 0.9132 0.0000 1093741.03 1093741.03 0.00 18434.42 18434.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.04 81.32% 9027.37 7949 11539 9031.95 8720 9498 749642 749642 0.00
crit 19.07 18.68% 18041.96 15898 23078 18050.76 16506 19980 344099 344099 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2054 5.1% 75.9 3.87sec 8125 0 Direct 75.9 8125 0 8125 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.92 75.92 0.00 0.00 0.0000 0.0000 616880.94 616880.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.92 100.00% 8125.47 5962 17308 8130.35 7168 9523 616881 616881 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6377.12
  • base_dd_max:6377.12
  • base_dd_mult:1.00
 
Starsurge 14249 35.6% 62.0 4.88sec 69031 66289 Direct 61.8 58378 116681 69254 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.99 61.79 0.00 0.00 1.0414 0.0000 4278945.98 4278945.98 0.00 66288.86 66288.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.26 81.34% 58377.76 51347 73781 58404.74 56379 61353 2934005 2934005 0.00
crit 11.53 18.66% 116681.40 102695 147561 116737.85 104342 137269 1344941 1344941 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 5925 14.7% 91.1 3.08sec 19430 0 Direct 91.1 16389 32787 19432 18.5%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.11 91.11 0.00 0.00 0.0000 0.0000 1770360.70 1770360.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.22 81.45% 16389.43 16021 17623 16389.03 16021 17184 1216358 1216358 0.00
crit 16.90 18.55% 32787.34 32042 35246 32787.99 32042 35032 554003 554003 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3325 8.3% 17.9 16.73sec 55725 54713 Direct 17.9 4704 9404 5574 18.5%  
Periodic 223.5 3389 6776 4022 18.7% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.92 17.92 223.50 223.50 1.0185 1.3319 998783.00 998783.00 0.00 3161.29 54712.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.61 81.50% 4703.66 4112 5970 4705.15 4342 5287 68707 68707 0.00
crit 3.32 18.50% 9404.29 8225 11939 9143.21 0 11939 31187 31187 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.7 81.31% 3388.86 3 4328 3390.45 3301 3554 615863 615863 0.00
crit 41.8 18.69% 6776.20 112 8656 6778.90 6350 7312 283025 283025 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
ripple in space
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.60sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.39sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9065 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.5 43.9sec 4.9sec 92.63% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:12.26%
  • arcanic_pulsar_2:10.19%
  • arcanic_pulsar_3:11.15%
  • arcanic_pulsar_4:10.65%
  • arcanic_pulsar_5:13.04%
  • arcanic_pulsar_6:11.53%
  • arcanic_pulsar_7:11.19%
  • arcanic_pulsar_8:12.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.7sec 0.0sec 16.17% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.09% 7.60% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.48% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 38.0sec 38.0sec 25.96% 35.86% 0.0(0.0) 8.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.5sec 46.1sec 23.49% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.4 0.0 60.8sec 60.8sec 14.14% 0.00% 84.9(84.9) 5.2

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.24% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.80%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 40.8 41.8 7.5sec 3.6sec 77.87% 99.76% 1.8(1.8) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:38.53%
  • lunar_empowerment_2:26.12%
  • lunar_empowerment_3:13.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.6sec 33.7sec 48.08% 0.00% 3.5(49.2) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.24%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.45%
  • overwhelming_power_22:2.52%
  • overwhelming_power_23:2.60%
  • overwhelming_power_24:2.67%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reality Shift 9.7 0.0 32.3sec 32.3sec 62.48% 0.00% 187.6(187.6) 9.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_reality_shift
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:intellect
  • amount:805.18

Stack Uptimes

  • reality_shift_1:62.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302916
  • name:Reality Shift
  • tooltip:
  • description:$?a302961[Your movement speed is increased by {$302961s1=5}%, and when][When] you move more than {$s1=25} yds within {$s4=4} sec, gain {$s2=194} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] for {$302952d=15 seconds}. This can only occur once every {$302953d=30 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 29.5 48.5 10.2sec 3.9sec 82.41% 74.46% 0.1(0.1) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:33.75%
  • solar_empowerment_2:35.92%
  • solar_empowerment_3:12.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.7 20.3sec 4.9sec 97.66% 92.84% 16.5(16.5) 12.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.68%
  • starlord_2:22.34%
  • starlord_3:59.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.5sec 45.3sec 23.76% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.76%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
ripple in space
starsurge Astral Power 62.0 2479.4 40.0 40.0 1725.8
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 102.61 820.46 (33.59%) 8.00 0.41 0.05%
celestial_alignment Astral Power 2.00 80.00 (3.28%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.93 212.31 (8.69%) 2.50 0.01 0.00%
sunfire Astral Power 17.92 53.77 (2.20%) 3.00 0.00 0.00%
moonfire Astral Power 14.10 42.29 (1.73%) 3.00 0.00 0.00%
lunar_strike Astral Power 79.72 956.31 (39.16%) 12.00 0.33 0.03%
natures_balance Astral Power 401.52 200.75 (8.22%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.37 76.47 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.12 8.24
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.87 0.00 60.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data ripple in space Fight Length
Count 3985
Mean 300.77
Minimum 240.06
Maximum 359.83
Spread ( max - min ) 119.77
Range [ ( max - min ) / 2 * 100% ] 19.91%
DPS
Sample Data ripple in space Damage Per Second
Count 3985
Mean 40073.58
Minimum 36119.65
Maximum 44430.92
Spread ( max - min ) 8311.28
Range [ ( max - min ) / 2 * 100% ] 10.37%
Standard Deviation 1209.6899
5th Percentile 38181.67
95th Percentile 42144.12
( 95th Percentile - 5th Percentile ) 3962.45
Mean Distribution
Standard Deviation 19.1628
95.00% Confidence Intervall ( 40036.02 - 40111.14 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3501
0.1 Scale Factor Error with Delta=300 12492
0.05 Scale Factor Error with Delta=300 49968
0.01 Scale Factor Error with Delta=300 1249200
Priority Target DPS
Sample Data ripple in space Priority Target Damage Per Second
Count 3985
Mean 40073.58
Minimum 36119.65
Maximum 44430.92
Spread ( max - min ) 8311.28
Range [ ( max - min ) / 2 * 100% ] 10.37%
Standard Deviation 1209.6899
5th Percentile 38181.67
95th Percentile 42144.12
( 95th Percentile - 5th Percentile ) 3962.45
Mean Distribution
Standard Deviation 19.1628
95.00% Confidence Intervall ( 40036.02 - 40111.14 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3501
0.1 Scale Factor Error with Delta=300 12492
0.05 Scale Factor Error with Delta=300 49968
0.01 Scale Factor Error with Delta=300 1249200
DPS(e)
Sample Data ripple in space Damage Per Second (Effective)
Count 3985
Mean 40073.58
Minimum 36119.65
Maximum 44430.92
Spread ( max - min ) 8311.28
Range [ ( max - min ) / 2 * 100% ] 10.37%
Damage
Sample Data ripple in space Damage
Count 3985
Mean 12026683.95
Minimum 9507479.30
Maximum 14986698.08
Spread ( max - min ) 5479218.78
Range [ ( max - min ) / 2 * 100% ] 22.78%
DTPS
Sample Data ripple in space Damage Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ripple in space Healing Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ripple in space Healing Per Second (Effective)
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ripple in space Heal
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ripple in space Healing Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ripple in space Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ripple in spaceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ripple in space Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.37 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.37 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.99 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.00 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.89 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.78 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.20 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 80.08 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 101.86 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.14 sunfire

Sample Sequence

012345678ACDKONPHFGIKQKQPKQPKQPQKNQOQPQKQPQKLPPPKQPKQPQPQQQQQOQKKNPPKQPQKQPQPQPQKNKOIPPQKQPQPQQJKNKQPKMPPKQPPKQPQNQKPQQQKOPQQKPPQNQQQKPKQPQGIKMPKQPNQQQQQQKKPPKQPPOQKNQPPQQPKKPPQQKNQPKQMPQQQQPKPKPNQQHEFIKQKOKQPQPQPKQKNQPKQPQKQPQMPQQQQKKNPPQKQPQPQKOQPNQKPQGQKPPIQKPQQQQNKOQPKQKLPPKPQQKPPQQPOQKNPKPQQKPQQQPQQNQKKOQPKQIPPKPQKNQPQPOQKQPKQPKQP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ripple in space 58.0/100: 58% astral_power
Pre precombat 1 food ripple in space 58.0/100: 58% astral_power
Pre precombat 2 augmentation ripple in space 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.163 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.089 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.269 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.076 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.076 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.076 default I fury_of_elune Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.832 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.585 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.340 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.095 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.850 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.695 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.451 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.206 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.962 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.718 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.472 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.227 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.982 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.735 default N sunfire Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.489 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.242 default O moonfire Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.995 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.749 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.529 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.284 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.038 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, reality_shift, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.792 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power bloodlust, reality_shift, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.597 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, reality_shift, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.352 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, reality_shift, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(12), ignition_mages_fuse(5)
0:24.107 default L sunfire Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(11), ignition_mages_fuse(5)
0:24.862 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(11), ignition_mages_fuse(5)
0:25.770 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(10)
0:26.875 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(9)
0:27.985 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(8)
0:28.860 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7)
0:29.615 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6)
0:30.562 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(5)
0:31.316 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(4)
0:32.073 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3)
0:33.030 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment(3), starlord(3), overwhelming_power(2)
0:33.785 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(2)
0:34.918 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar, solar_empowerment(3), starlord(3), overwhelming_power
0:35.673 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, reality_shift, arcanic_pulsar, solar_empowerment(2), starlord(3)
0:36.426 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, reality_shift, arcanic_pulsar, solar_empowerment, starlord(3)
0:37.181 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, reality_shift, arcanic_pulsar, starlord(3)
0:38.057 default Q solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, reality_shift, arcanic_pulsar, starlord(3)
0:38.933 default O moonfire Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, reality_shift, arcanic_pulsar, starlord(3)
0:39.809 default Q solar_wrath Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, reality_shift, arcanic_pulsar, starlord(3)
0:40.685 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power bloodlust, reality_shift, arcanic_pulsar
0:41.639 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord
0:42.841 default N sunfire Fluffy_Pillow 20.5/100: 21% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
0:44.009 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
0:45.497 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
0:46.985 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment(2), starlord(2), torrent_of_elements
0:48.154 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
0:49.121 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:50.571 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(3), starlord(3), torrent_of_elements
0:51.539 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements
0:52.675 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
0:53.641 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:55.089 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements
0:56.055 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
0:57.502 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3)
0:58.467 default P lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3)
0:59.913 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(24)
1:00.801 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(5), overwhelming_power(23)
1:01.942 default N sunfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22)
1:03.054 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20)
1:04.173 default O moonfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19)
1:05.264 default I fury_of_elune Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18)
1:06.360 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17)
1:07.760 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(16)
1:09.164 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(3), starlord(2), overwhelming_power(14)
1:10.108 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), overwhelming_power(13)
1:11.223 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(12)
1:12.147 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11)
1:13.537 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(10)
1:14.470 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(9)
1:15.868 default Q solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(8)
1:16.806 default Q solar_wrath Fluffy_Pillow 92.0/100: 92% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(7)
1:17.914 default J cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(6)
1:17.914 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, overwhelming_power(6)
1:19.125 default N sunfire Fluffy_Pillow 73.0/100: 73% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(4)
1:20.155 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(3)
1:21.189 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(2)
1:22.047 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(25)
1:23.231 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(24)
1:24.163 default M moonfire Fluffy_Pillow 19.5/100: 20% astral_power reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
1:25.073 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
1:26.410 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21)
1:27.751 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20)
1:28.809 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19)
1:29.713 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18)
1:31.070 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
1:32.399 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
1:33.446 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(22)
1:34.340 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21)
1:35.682 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20)
1:36.582 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19)
1:37.645 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18)
1:38.551 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
1:39.715 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers
1:41.160 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
1:42.130 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), starlord, torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers
1:43.276 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), starlord, torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers
1:44.425 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(5), starlord, torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers
1:45.579 default O moonfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
1:46.706 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(9), conch_of_dark_whispers
1:48.147 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(25), conch_of_dark_whispers
1:49.055 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power reality_shift, arcanic_pulsar(6), starlord(2), overwhelming_power(24), conch_of_dark_whispers
1:50.127 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, starlord(2), overwhelming_power(23), conch_of_dark_whispers
1:51.205 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers
1:52.542 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers
1:53.884 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(20)
1:54.784 default N sunfire Fluffy_Pillow 37.0/100: 37% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(19)
1:55.846 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(18)
1:56.753 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power reality_shift, arcanic_pulsar(7), starlord(3), overwhelming_power(17)
1:57.822 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power reality_shift, arcanic_pulsar(7), starlord(3), overwhelming_power(16)
1:58.893 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power reality_shift, arcanic_pulsar(7), overwhelming_power(15)
2:00.065 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13)
2:01.524 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord, overwhelming_power(12)
2:02.675 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(11)
2:03.503 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(10)
2:04.750 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power reality_shift, celestial_alignment, solar_empowerment(2), starlord(2), overwhelming_power(9)
2:05.585 default G use_items Fluffy_Pillow 43.0/100: 43% astral_power reality_shift, celestial_alignment, solar_empowerment, starlord(2), overwhelming_power(8)
2:05.585 default I fury_of_elune Fluffy_Pillow 43.0/100: 43% astral_power reality_shift, celestial_alignment, solar_empowerment, starlord(2), overwhelming_power(8), ignition_mages_fuse
2:06.534 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power reality_shift, celestial_alignment, fury_of_elune, solar_empowerment, starlord(2), overwhelming_power(7), ignition_mages_fuse
2:07.483 default M moonfire Fluffy_Pillow 11.5/100: 12% astral_power reality_shift, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6), ignition_mages_fuse
2:08.410 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power reality_shift, arcanic_pulsar, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), ignition_mages_fuse
2:09.773 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(4), ignition_mages_fuse(2)
2:10.804 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(3), ignition_mages_fuse(2)
2:11.680 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2), ignition_mages_fuse(2)
2:13.001 default N sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), fury_of_elune, solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:14.046 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
2:14.898 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), ignition_mages_fuse(3)
2:15.752 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(2), starlord(3), ignition_mages_fuse(3)
2:16.755 default Q solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(2), starlord(3), ignition_mages_fuse(3)
2:17.758 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(2), starlord(3), ignition_mages_fuse(4)
2:18.725 default Q solar_wrath Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(2), starlord(3), ignition_mages_fuse(4)
2:19.691 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power reality_shift, arcanic_pulsar(2), ignition_mages_fuse(4)
2:20.745 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse(4)
2:21.767 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
2:22.987 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
2:24.207 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
2:25.163 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse(5)
2:25.956 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:27.405 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
2:28.853 default O moonfire Fluffy_Pillow 40.5/100: 41% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment(3), starlord(3)
2:29.991 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment(3), starlord(3)
2:30.958 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment(2), starlord(3)
2:32.094 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
2:33.232 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
2:34.199 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:35.647 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
2:37.094 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment(2), starlord(3)
2:38.060 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment, starlord(3)
2:39.027 default P lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3)
2:40.474 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(6), overwhelming_power(25)
2:41.609 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24)
2:42.712 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23)
2:44.082 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21)
2:45.463 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), overwhelming_power(20)
2:46.387 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(19)
2:47.314 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(18)
2:48.409 default N sunfire Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17)
2:49.341 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16)
2:50.133 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15)
2:51.324 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14)
2:52.264 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13)
2:53.066 default M moonfire Fluffy_Pillow 13.5/100: 14% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12)
2:54.012 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11)
2:55.401 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power reality_shift, arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10)
2:56.334 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power reality_shift, arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(9)
2:57.432 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power reality_shift, arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(8)
2:58.534 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power reality_shift, arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers
2:59.643 default P lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power reality_shift, arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers
3:01.060 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power reality_shift, arcanic_pulsar, torrent_of_elements, overwhelming_power(4), conch_of_dark_whispers
3:02.281 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(3), conch_of_dark_whispers
3:03.795 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment, starlord, overwhelming_power(2), conch_of_dark_whispers
3:04.988 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power, conch_of_dark_whispers
3:06.472 default N sunfire Fluffy_Pillow 25.5/100: 26% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:07.641 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:08.635 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment, starlord(2), conch_of_dark_whispers
3:09.629 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power reality_shift, arcanic_pulsar(3), celestial_alignment, starlord(2), conch_of_dark_whispers
3:10.645 default E potion Fluffy_Pillow 87.5/100: 88% astral_power reality_shift, arcanic_pulsar(3), celestial_alignment, starlord(2), conch_of_dark_whispers
3:10.645 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power reality_shift, arcanic_pulsar(3), celestial_alignment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:10.645 default I fury_of_elune Fluffy_Pillow 87.5/100: 88% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:11.570 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, fury_of_elune, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:12.493 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:13.258 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:14.158 default O moonfire Fluffy_Pillow 35.0/100: 35% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:15.059 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:15.959 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power berserking, arcanic_pulsar(6), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:16.722 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power berserking, arcanic_pulsar(6), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:17.867 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power berserking, arcanic_pulsar(6), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:18.632 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power berserking, arcanic_pulsar(6), celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:19.776 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:20.676 default P lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:21.822 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power berserking, arcanic_pulsar(6), celestial_alignment, conch_of_dark_whispers, battle_potion_of_intellect
3:22.801 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:23.691 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:24.653 default N sunfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:25.588 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:26.388 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:27.588 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(20), battle_potion_of_intellect
3:28.533 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), battle_potion_of_intellect
3:29.318 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(18), battle_potion_of_intellect
3:30.500 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(17), battle_potion_of_intellect
3:31.428 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(16), battle_potion_of_intellect
3:32.363 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), battle_potion_of_intellect
3:33.161 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(14), battle_potion_of_intellect
3:34.357 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(13), battle_potion_of_intellect
3:35.300 default M moonfire Fluffy_Pillow 34.0/100: 34% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(12), battle_potion_of_intellect
3:36.247 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power reality_shift, arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(11)
3:37.639 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power reality_shift, arcanic_pulsar, starlord(3), overwhelming_power(24)
3:38.681 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power reality_shift, arcanic_pulsar, starlord(3), overwhelming_power(23)
3:39.728 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power reality_shift, arcanic_pulsar, starlord(3), overwhelming_power(22)
3:40.778 default Q solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power reality_shift, arcanic_pulsar, starlord(3), overwhelming_power(21)
3:41.830 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power reality_shift, arcanic_pulsar, overwhelming_power(20)
3:42.982 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(19)
3:44.107 default N sunfire Fluffy_Pillow 6.5/100: 7% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17)
3:45.206 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16)
3:46.611 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15)
3:48.019 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment(3), starlord(2), overwhelming_power(13)
3:48.965 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(13)
3:50.081 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(11)
3:51.009 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10)
3:52.404 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), overwhelming_power(9)
3:53.339 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8)
3:54.744 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), overwhelming_power(7)
3:55.687 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(6)
3:56.798 default O moonfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(5)
3:57.913 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(4)
3:58.864 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3)
4:00.296 default N sunfire Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power
4:01.428 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
4:02.313 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(5), solar_empowerment, torrent_of_elements, overwhelming_power(23)
4:03.453 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(22)
4:04.868 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(21)
4:05.815 default G use_items Fluffy_Pillow 38.0/100: 38% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20)
4:05.815 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20), ignition_mages_fuse
4:06.730 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, starlord, torrent_of_elements, overwhelming_power(19), ignition_mages_fuse
4:07.808 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(18), ignition_mages_fuse
4:09.147 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(16), ignition_mages_fuse
4:10.494 default I fury_of_elune Fluffy_Pillow 33.0/100: 33% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15), ignition_mages_fuse(2)
4:11.665 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power reality_shift, arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(14), ignition_mages_fuse(2)
4:12.536 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power reality_shift, arcanic_pulsar(7), fury_of_elune, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(13), ignition_mages_fuse(2)
4:13.563 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power reality_shift, arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), ignition_mages_fuse(2)
4:14.842 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power reality_shift, arcanic_pulsar(8), fury_of_elune, solar_empowerment(3), starlord(3), overwhelming_power(11), ignition_mages_fuse(3)
4:15.666 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power reality_shift, arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(10), ignition_mages_fuse(3)
4:16.493 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power reality_shift, arcanic_pulsar(8), fury_of_elune, solar_empowerment, starlord(3), overwhelming_power(9), ignition_mages_fuse(3)
4:17.323 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power reality_shift, arcanic_pulsar(8), fury_of_elune, starlord(3), overwhelming_power(8), ignition_mages_fuse(3)
4:18.301 default N sunfire Fluffy_Pillow 88.0/100: 88% astral_power reality_shift, arcanic_pulsar(8), fury_of_elune, starlord(3), overwhelming_power(7), ignition_mages_fuse(4)
4:19.246 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power reality_shift, arcanic_pulsar(8), starlord(3), overwhelming_power(6), ignition_mages_fuse(4)
4:20.193 default O moonfire Fluffy_Pillow 66.5/100: 67% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5), ignition_mages_fuse(4)
4:21.020 default Q solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(4), ignition_mages_fuse(4)
4:21.774 default P lunar_strike Fluffy_Pillow 79.0/100: 79% astral_power reality_shift, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(4), ignition_mages_fuse(4)
4:22.831 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power reality_shift, celestial_alignment, overwhelming_power(3), ignition_mages_fuse(5)
4:23.707 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(2), conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.462 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, overwhelming_power, conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.316 default L sunfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.150 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers
4:27.638 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers
4:29.125 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), solar_empowerment, starlord(2), conch_of_dark_whispers
4:30.294 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:31.740 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:32.707 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), conch_of_dark_whispers
4:33.673 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), conch_of_dark_whispers
4:34.811 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
4:36.257 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
4:37.705 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment, starlord(3), conch_of_dark_whispers
4:38.672 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power reality_shift, arcanic_pulsar(4), starlord(3)
4:39.809 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, starlord(3)
4:41.258 default O moonfire Fluffy_Pillow 59.0/100: 59% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment, starlord(3)
4:42.393 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment, starlord(3)
4:43.361 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power reality_shift, arcanic_pulsar(4)
4:44.600 default N sunfire Fluffy_Pillow 32.0/100: 32% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord
4:45.802 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord
4:47.333 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment, starlord
4:48.535 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2)
4:50.024 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment(3), starlord(2)
4:51.018 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment(2), starlord(2)
4:52.013 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment, starlord(2)
4:53.181 default P lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
4:54.630 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
4:55.596 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
4:56.563 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), starlord(3)
4:57.700 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3)
4:59.148 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), starlord(3)
5:00.287 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(7), starlord(3)
5:01.424 default N sunfire Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(7), starlord(3)
5:02.559 default Q solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(7), starlord(3)
5:03.696 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(7)
5:04.933 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
5:06.135 default O moonfire Fluffy_Pillow 16.5/100: 17% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
5:07.152 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
5:08.018 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power reality_shift, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2)
5:09.313 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
5:10.329 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
5:11.170 default I fury_of_elune Fluffy_Pillow 10.5/100: 11% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
5:12.160 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power reality_shift, arcanic_pulsar, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3)
5:13.607 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power reality_shift, arcanic_pulsar, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3)
5:15.052 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power reality_shift, arcanic_pulsar, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3)
5:16.187 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power reality_shift, arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3)
5:17.633 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3)
5:18.601 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power reality_shift, arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3)
5:19.737 default N sunfire Fluffy_Pillow 20.5/100: 21% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
5:20.875 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
5:21.842 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers
5:23.167 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), conch_of_dark_whispers
5:24.056 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), overwhelming_power(22), conch_of_dark_whispers
5:25.515 default O moonfire Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), overwhelming_power(21), conch_of_dark_whispers
5:26.665 default Q solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), overwhelming_power(20), conch_of_dark_whispers
5:27.645 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), overwhelming_power(19), conch_of_dark_whispers
5:28.803 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(18), conch_of_dark_whispers
5:29.763 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(17), conch_of_dark_whispers
5:31.201 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(15), conch_of_dark_whispers
5:32.340 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(14), conch_of_dark_whispers
5:33.285 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), conch_of_dark_whispers
5:34.704 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(12), conch_of_dark_whispers
5:35.823 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11), conch_of_dark_whispers
5:36.751 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="ripple in space"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

unbound force : 39830 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
39830.4 39830.4 37.4 / 0.094% 4543.2 / 11.4% 4821.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.2 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
unbound force 39830
Fury of Elune 917 2.3% 5.4 60.74sec 51110 51769 Direct 133.4 1684 3330 2060 22.9%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 133.40 143.58 0.00 0.9873 0.2958 274839.77 274839.77 0.00 5751.71 51768.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 102.90 77.14% 1684.07 1457 1987 1685.59 1596 1856 173296 173296 0.00
crit 30.50 22.86% 3329.74 2915 3974 3332.95 3006 3755 101544 101544 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 307 (439) 0.8% (1.1%) 8.3 32.95sec 15958 0 Direct 8.3 9127 18253 11164 22.3%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.27 8.27 0.00 0.00 0.0000 0.0000 92293.91 92293.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.42 77.68% 9126.75 8921 9813 9118.69 0 9813 58617 58617 0.00
crit 1.84 22.32% 18253.21 17842 19626 15446.86 0 19626 33677 33677 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 132 0.3% 8.3 32.95sec 4795 0 Direct 8.3 3911 7826 4795 22.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.27 8.27 0.00 0.00 0.0000 0.0000 39642.32 39642.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.40 77.42% 3911.05 3823 4206 3909.36 0 4206 25034 25034 0.00
crit 1.87 22.58% 7825.62 7646 8411 6673.70 0 8411 14608 14608 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6147 15.5% 79.6 3.75sec 23202 17848 Direct 79.6 19030 37972 23201 22.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.61 79.61 0.00 0.00 1.3000 0.0000 1846987.92 1846987.92 0.00 17848.05 17848.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.07 77.97% 19029.72 10135 24211 19036.83 18434 19850 1181219 1181219 0.00
crit 17.53 22.03% 37971.78 20270 48422 37985.99 35258 42126 665769 665769 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3237 8.1% 14.1 21.40sec 68931 68729 Direct 14.1 3612 7218 4406 22.0%  
Periodic 224.2 3327 6633 4059 22.1% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.10 14.10 224.24 224.24 1.0029 1.3315 972247.27 972247.27 0.00 3108.89 68729.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.00 77.98% 3612.24 3280 4472 3614.59 3344 3973 39729 39729 0.00
crit 3.11 22.02% 7217.71 6559 8943 7034.50 0 8943 22419 22419 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.6 77.87% 3326.66 2 4163 3328.09 3231 3474 580861 580861 0.00
crit 49.6 22.13% 6633.19 21 8327 6635.38 6323 7179 329239 329239 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 3586 (5605) 9.0% (14.1%) 101.7 2.89sec 16558 18123 Direct 102.2 8655 17271 10540 21.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.70 102.23 0.00 0.00 0.9136 0.0000 1077519.80 1077519.80 0.00 18122.76 18122.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.87 78.13% 8655.17 7949 10838 8659.66 8358 9102 691307 691307 0.00
crit 22.36 21.87% 17271.44 15898 21676 17281.29 16157 18958 386213 386213 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2019 5.1% 75.9 3.86sec 7993 0 Direct 75.9 7993 0 7993 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.87 75.87 0.00 0.00 0.0000 0.0000 606411.08 606411.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.87 100.00% 7992.66 5962 16257 7996.99 6850 9342 606411 606411 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11923.38
  • base_dd_max:11923.38
  • base_dd_mult:1.00
 
Starsurge 14129 35.5% 62.0 4.88sec 68450 65729 Direct 61.8 56181 111990 68676 22.4%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.99 61.79 0.00 0.00 1.0414 0.0000 4243231.53 4243231.53 0.00 65729.47 65729.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.95 77.61% 56180.63 51347 69612 56204.39 53797 58932 2694072 2694072 0.00
crit 13.83 22.39% 111990.05 102695 139223 112043.75 102695 126566 1549160 1549160 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 6081 15.2% 91.1 3.07sec 19947 0 Direct 91.1 16388 32788 19946 21.7%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.09 91.09 0.00 0.00 0.0000 0.0000 1816870.58 1816870.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.32 78.30% 16387.71 16021 17623 16387.74 16021 17264 1168805 1168805 0.00
crit 19.77 21.70% 32787.87 32042 35246 32788.87 32042 34999 648065 648065 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3276 8.2% 17.9 16.73sec 54853 53875 Direct 17.9 4510 9009 5508 22.2%  
Periodic 223.5 3249 6478 3960 22.0% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.94 17.94 223.52 223.52 1.0182 1.3320 984024.92 984024.92 0.00 3114.15 53874.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.96 77.81% 4509.98 4112 5607 4511.06 4242 4865 62952 62952 0.00
crit 3.98 22.19% 9009.27 8225 11214 8912.67 0 11214 35864 35864 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.3 77.97% 3248.97 8 4065 3250.33 3162 3391 566231 566231 0.00
crit 49.2 22.03% 6477.98 4 8130 6480.47 6101 6926 318978 318978 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
unbound force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.52sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.31sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9068 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.5 43.9sec 4.9sec 92.63% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:12.21%
  • arcanic_pulsar_2:10.27%
  • arcanic_pulsar_3:11.08%
  • arcanic_pulsar_4:10.66%
  • arcanic_pulsar_5:13.02%
  • arcanic_pulsar_6:11.54%
  • arcanic_pulsar_7:11.21%
  • arcanic_pulsar_8:12.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.6sec 0.0sec 16.17% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.09% 7.54% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.48% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.9sec 37.9sec 25.96% 35.87% 0.0(0.0) 8.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.7sec 23.69% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.4 0.0 60.8sec 60.8sec 14.14% 0.00% 84.9(84.9) 5.2

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.24% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 40.9 41.5 7.4sec 3.7sec 77.76% 99.74% 1.8(1.8) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:38.64%
  • lunar_empowerment_2:26.03%
  • lunar_empowerment_3:13.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.2sec 33.7sec 48.24% 0.00% 3.5(48.7) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.43%
  • overwhelming_power_3:1.47%
  • overwhelming_power_4:1.51%
  • overwhelming_power_5:1.55%
  • overwhelming_power_6:1.59%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.68%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.18%
  • overwhelming_power_18:2.24%
  • overwhelming_power_19:2.31%
  • overwhelming_power_20:2.38%
  • overwhelming_power_21:2.45%
  • overwhelming_power_22:2.53%
  • overwhelming_power_23:2.60%
  • overwhelming_power_24:2.67%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reckless Force 4.0 0.0 67.5sec 67.5sec 5.24% 0.00% 0.0(0.0) 3.9

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_1:5.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302932
  • name:Reckless Force
  • tooltip:Critical Strike increased by {$s1=50}%.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Reckless Force (_counter) 4.9 83.8 67.4sec 3.4sec 91.55% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force_counter
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_counter_1:5.57%
  • reckless_force_counter_2:5.22%
  • reckless_force_counter_3:5.17%
  • reckless_force_counter_4:5.12%
  • reckless_force_counter_5:5.04%
  • reckless_force_counter_6:5.00%
  • reckless_force_counter_7:4.94%
  • reckless_force_counter_8:4.89%
  • reckless_force_counter_9:4.85%
  • reckless_force_counter_10:4.78%
  • reckless_force_counter_11:4.80%
  • reckless_force_counter_12:4.72%
  • reckless_force_counter_13:4.65%
  • reckless_force_counter_14:4.63%
  • reckless_force_counter_15:4.56%
  • reckless_force_counter_16:4.49%
  • reckless_force_counter_17:4.41%
  • reckless_force_counter_18:4.40%
  • reckless_force_counter_19:4.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302917
  • name:Reckless Force
  • tooltip:Upon reaching {$u=20} stacks, you gain $302932s~1% Critical Strike for {$302932d=3 seconds}.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 29.4 48.6 10.3sec 3.9sec 82.37% 74.33% 0.1(0.1) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:33.70%
  • solar_empowerment_2:35.85%
  • solar_empowerment_3:12.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.7 20.3sec 4.9sec 97.63% 92.86% 16.5(16.5) 12.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.74%
  • starlord_2:22.30%
  • starlord_3:59.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.7sec 45.3sec 23.79% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.79%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
unbound force
starsurge Astral Power 62.0 2479.6 40.0 40.0 1711.3
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 102.71 821.27 (33.63%) 8.00 0.39 0.05%
celestial_alignment Astral Power 2.00 80.00 (3.28%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.92 212.31 (8.69%) 2.50 0.00 0.00%
sunfire Astral Power 17.94 53.82 (2.20%) 3.00 0.00 0.00%
moonfire Astral Power 14.10 42.31 (1.73%) 3.00 0.00 0.00%
lunar_strike Astral Power 79.60 954.90 (39.11%) 12.00 0.34 0.04%
natures_balance Astral Power 401.52 200.75 (8.22%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.37 76.41 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.12 8.24
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.00 0.00 69.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data unbound force Fight Length
Count 3985
Mean 300.77
Minimum 240.06
Maximum 359.83
Spread ( max - min ) 119.77
Range [ ( max - min ) / 2 * 100% ] 19.91%
DPS
Sample Data unbound force Damage Per Second
Count 3985
Mean 39830.39
Minimum 36298.57
Maximum 44436.00
Spread ( max - min ) 8137.44
Range [ ( max - min ) / 2 * 100% ] 10.22%
Standard Deviation 1205.8837
5th Percentile 37942.05
95th Percentile 41850.66
( 95th Percentile - 5th Percentile ) 3908.62
Mean Distribution
Standard Deviation 19.1025
95.00% Confidence Intervall ( 39792.95 - 39867.83 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3522
0.1 Scale Factor Error with Delta=300 12414
0.05 Scale Factor Error with Delta=300 49655
0.01 Scale Factor Error with Delta=300 1241351
Priority Target DPS
Sample Data unbound force Priority Target Damage Per Second
Count 3985
Mean 39830.39
Minimum 36298.57
Maximum 44436.00
Spread ( max - min ) 8137.44
Range [ ( max - min ) / 2 * 100% ] 10.22%
Standard Deviation 1205.8837
5th Percentile 37942.05
95th Percentile 41850.66
( 95th Percentile - 5th Percentile ) 3908.62
Mean Distribution
Standard Deviation 19.1025
95.00% Confidence Intervall ( 39792.95 - 39867.83 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3522
0.1 Scale Factor Error with Delta=300 12414
0.05 Scale Factor Error with Delta=300 49655
0.01 Scale Factor Error with Delta=300 1241351
DPS(e)
Sample Data unbound force Damage Per Second (Effective)
Count 3985
Mean 39830.39
Minimum 36298.57
Maximum 44436.00
Spread ( max - min ) 8137.44
Range [ ( max - min ) / 2 * 100% ] 10.22%
Damage
Sample Data unbound force Damage
Count 3985
Mean 11954069.09
Minimum 9201601.31
Maximum 14739485.31
Spread ( max - min ) 5537884.00
Range [ ( max - min ) / 2 * 100% ] 23.16%
DTPS
Sample Data unbound force Damage Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data unbound force Healing Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data unbound force Healing Per Second (Effective)
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data unbound force Heal
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data unbound force Healing Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data unbound force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data unbound forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data unbound force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.38 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.32 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.99 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.02 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.87 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.77 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.23 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 79.96 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 101.96 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.15 sunfire

Sample Sequence

012345678ACDKONPHFGIKQKQPKQPQKQPNQPOQPJKQKQPKLPPPQQQQQKQKQPQPQMKKPNPKQPPQKPQQQQQQKNOKIPPKQPQQQQQJKNKQPKMPPKQPQQPQPNKKPPQOQKPQQQKPNQQKPQQPGKIQPKQMKNPPQQPKPKPQPKPOQNQKPQQQQKPQQKPQNQOKQPQPQLQKPKPQQHEFIKQKQPKOQPNQPQKQKQPKLPPPQQPOQQJKQKQPKLPKPPPQQPOQQKKPNGPKQIPQKQPKQPPOQKNQKQPQLKPPQPKPQPQQKOPKNPQQQKPQQQPQQQKKNOPQPIQKQPKQPLPQJKQKQOPKQPPKQPP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask unbound force 58.0/100: 58% astral_power
Pre precombat 1 food unbound force 58.0/100: 58% astral_power
Pre precombat 2 augmentation unbound force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.237 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.162 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:03.087 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(2), battle_potion_of_intellect
0:04.265 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, reckless_force_counter(2), battle_potion_of_intellect
0:05.071 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, reckless_force_counter(2), battle_potion_of_intellect
0:05.071 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, reckless_force_counter(2), battle_potion_of_intellect
0:05.071 default I fury_of_elune Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:05.825 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord, reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.580 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.334 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.088 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.840 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.684 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.439 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.192 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.001 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.756 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.511 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.266 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.045 default N sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(5), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.798 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(5), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.554 default P lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), reckless_force_counter(5), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.332 default O moonfire Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), reckless_force_counter(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.087 default Q solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), reckless_force_counter(6), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.842 default P lunar_strike Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), reckless_force_counter(6), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.665 default J cancel_buff Fluffy_Pillow 99.0/100: 99% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), reckless_force_counter(6), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.665 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, reckless_force_counter(6), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.419 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.174 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.930 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.685 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), reckless_force_counter(8), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.502 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), reckless_force_counter(8), ignition_mages_fuse(5)
0:24.256 default L sunfire Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(9), ignition_mages_fuse(5)
0:25.010 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(9), ignition_mages_fuse(5)
0:25.924 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(9)
0:27.039 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(9), conch_of_dark_whispers
0:28.153 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), reckless_force_counter(9), conch_of_dark_whispers
0:28.909 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar(8), starlord(3), reckless_force_counter(9), conch_of_dark_whispers
0:29.783 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, arcanic_pulsar(8), starlord(3), reckless_force_counter(10), conch_of_dark_whispers
0:30.658 default Q solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, arcanic_pulsar(8), starlord(3), reckless_force_counter(10), conch_of_dark_whispers
0:31.531 default Q solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, arcanic_pulsar(8), starlord(3), reckless_force_counter(10), conch_of_dark_whispers
0:32.406 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar(8), starlord(3), reckless_force_counter(10), conch_of_dark_whispers
0:33.282 default Q solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(10), conch_of_dark_whispers
0:34.037 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), reckless_force_counter(10), conch_of_dark_whispers
0:34.798 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(10), conch_of_dark_whispers
0:35.554 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), reckless_force_counter(10), conch_of_dark_whispers
0:36.525 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), reckless_force_counter(10), conch_of_dark_whispers
0:37.288 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), reckless_force_counter(10), conch_of_dark_whispers
0:38.259 default Q solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), reckless_force_counter(10), conch_of_dark_whispers
0:39.020 default M moonfire Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), reckless_force_counter(10), conch_of_dark_whispers
0:39.783 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, reckless_force_counter(10), conch_of_dark_whispers
0:40.738 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(10), conch_of_dark_whispers
0:41.664 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(10), conch_of_dark_whispers
0:43.151 default N sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(10)
0:44.319 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(12)
0:45.807 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), reckless_force_counter(13)
0:46.976 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(13)
0:47.943 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(13)
0:49.390 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(13)
0:50.838 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), reckless_force_counter(14)
0:51.804 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), reckless_force_counter(14)
0:52.940 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(14)
0:54.387 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(14)
0:55.353 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(14)
0:56.319 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, reckless_force_counter(15)
0:57.455 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, reckless_force_counter(16)
0:58.593 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, reckless_force_counter(16)
0:59.730 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, reckless_force_counter(17)
1:00.866 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(5), torrent_of_elements, reckless_force_counter(17)
1:02.106 default N sunfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(17)
1:03.308 default O moonfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(17)
1:04.509 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(18)
1:05.711 default I fury_of_elune Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(18)
1:06.881 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(18)
1:08.368 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(19)
1:09.856 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), reckless_force_counter(19)
1:11.023 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(19)
1:11.988 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power reckless_force, arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3)
1:13.436 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power reckless_force, arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(25)
1:14.319 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power reckless_force, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(24)
1:15.205 default Q solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power reckless_force, arcanic_pulsar(8), starlord(3), overwhelming_power(23)
1:16.251 default Q solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(22)
1:17.302 default Q solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(21), reckless_force_counter
1:18.355 default J cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(20), reckless_force_counter
1:18.355 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), overwhelming_power(20), reckless_force_counter
1:19.509 default N sunfire Fluffy_Pillow 66.0/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(19), reckless_force_counter
1:20.486 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18), reckless_force_counter
1:21.467 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17), reckless_force_counter
1:22.280 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(16), reckless_force_counter
1:23.502 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(15), reckless_force_counter(3)
1:24.466 default M moonfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14), reckless_force_counter(4)
1:25.404 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13), reckless_force_counter(4)
1:26.785 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), reckless_force_counter(4), conch_of_dark_whispers
1:28.170 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(10), reckless_force_counter(5), conch_of_dark_whispers
1:29.264 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(9), reckless_force_counter(5), conch_of_dark_whispers
1:30.198 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8), reckless_force_counter(5), conch_of_dark_whispers
1:31.604 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(7), reckless_force_counter(6), conch_of_dark_whispers
1:32.545 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(6), reckless_force_counter(7), conch_of_dark_whispers
1:33.488 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power(5), reckless_force_counter(7), conch_of_dark_whispers
1:34.908 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(4), reckless_force_counter(7), conch_of_dark_whispers
1:36.026 default P lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power(2), reckless_force_counter(7), conch_of_dark_whispers
1:37.463 default N sunfire Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power, reckless_force_counter(8), conch_of_dark_whispers
1:38.596 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(3), reckless_force_counter(8), conch_of_dark_whispers
1:39.835 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(8), conch_of_dark_whispers
1:41.038 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(9), conch_of_dark_whispers
1:42.528 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(10)
1:44.017 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), reckless_force_counter(11)
1:45.011 default O moonfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), reckless_force_counter(11)
1:46.181 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), reckless_force_counter(12)
1:47.175 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), starlord(2), reckless_force_counter(12)
1:48.343 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(12)
1:49.790 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), reckless_force_counter(12)
1:50.756 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), starlord(3), reckless_force_counter(13)
1:51.892 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), starlord(3), reckless_force_counter(13)
1:53.028 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), starlord(3), reckless_force_counter(13)
1:54.164 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(13)
1:55.612 default N sunfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), reckless_force_counter(14)
1:56.749 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), reckless_force_counter(14)
1:57.717 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), starlord(3), reckless_force_counter(14)
1:58.854 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), reckless_force_counter(14)
2:00.092 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(15)
2:01.623 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(8), solar_empowerment, starlord, reckless_force_counter(15)
2:02.643 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), starlord, reckless_force_counter(15)
2:03.846 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment, starlord, reckless_force_counter(15)
2:05.378 default G use_items Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), starlord, reckless_force_counter(15)
2:05.378 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), starlord, reckless_force_counter(15), ignition_mages_fuse
2:06.529 default I fury_of_elune Fluffy_Pillow 20.0/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), reckless_force_counter(16), ignition_mages_fuse
2:07.502 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), reckless_force_counter(16), ignition_mages_fuse
2:08.330 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, starlord(2), reckless_force_counter(16), ignition_mages_fuse
2:09.570 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power celestial_alignment, fury_of_elune, starlord(2), reckless_force_counter(16), ignition_mages_fuse(2)
2:10.506 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(16), ignition_mages_fuse(2)
2:11.280 default M moonfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), reckless_force_counter(16), ignition_mages_fuse(2)
2:12.188 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starlord(3), reckless_force_counter(17), ignition_mages_fuse(2)
2:13.233 default N sunfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(17), ignition_mages_fuse(2)
2:14.279 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(18), ignition_mages_fuse(3)
2:15.557 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(18), ignition_mages_fuse(3)
2:16.837 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), reckless_force_counter(19), ignition_mages_fuse(3)
2:17.690 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(2), starlord(3), reckless_force_counter(19), ignition_mages_fuse(4)
2:18.656 default P lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power reckless_force, arcanic_pulsar(2), lunar_empowerment, starlord(3), ignition_mages_fuse(4)
2:19.887 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power reckless_force, arcanic_pulsar(2), ignition_mages_fuse(4)
2:20.939 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power reckless_force, arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse(4)
2:22.240 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power reckless_force, arcanic_pulsar(3), solar_empowerment, starlord, ignition_mages_fuse(5)
2:23.225 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
2:24.443 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
2:25.258 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), ignition_mages_fuse(5)
2:26.479 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), reckless_force_counter
2:27.646 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter
2:29.093 default O moonfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), reckless_force_counter
2:30.230 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), reckless_force_counter
2:31.197 default N sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), reckless_force_counter(2)
2:32.331 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), reckless_force_counter(3)
2:33.300 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), reckless_force_counter(3)
2:34.438 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(3)
2:35.885 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), reckless_force_counter(4)
2:36.851 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), reckless_force_counter(4)
2:37.818 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), starlord(3), reckless_force_counter(5)
2:38.956 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), starlord(3), reckless_force_counter(5)
2:40.093 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), reckless_force_counter(5)
2:41.332 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(5)
2:42.864 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), solar_empowerment, starlord, reckless_force_counter(5)
2:43.889 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), starlord, reckless_force_counter(6)
2:45.091 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), starlord, reckless_force_counter(6)
2:46.293 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), reckless_force_counter(6)
2:47.781 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), reckless_force_counter(7)
2:48.775 default N sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), starlord(2), reckless_force_counter(7)
2:49.942 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), starlord(2), reckless_force_counter(7)
2:51.111 default O moonfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), starlord(2), reckless_force_counter(7)
2:52.280 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), starlord(2), torrent_of_elements, reckless_force_counter(7)
2:53.449 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(9)
2:54.291 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(9)
2:55.552 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(10)
2:56.392 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(10)
2:57.650 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(25), reckless_force_counter(10)
2:58.554 default L sunfire Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(24), reckless_force_counter(10)
2:59.461 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power starlord(3), torrent_of_elements, overwhelming_power(23), reckless_force_counter(10)
3:00.506 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power torrent_of_elements, overwhelming_power(22), reckless_force_counter(10)
3:01.651 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21), reckless_force_counter(11)
3:03.071 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(19), reckless_force_counter(11)
3:04.194 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18), reckless_force_counter(11)
3:05.588 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17), reckless_force_counter(11)
3:06.521 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(16), reckless_force_counter(12)
3:07.458 default H celestial_alignment Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), celestial_alignment, starlord(2), overwhelming_power(15), reckless_force_counter(12)
3:08.421 default E potion Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(2), celestial_alignment, starlord(2), overwhelming_power(14), reckless_force_counter(12)
3:08.421 default F berserking Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(2), celestial_alignment, starlord(2), overwhelming_power(14), reckless_force_counter(12), battle_potion_of_intellect
3:08.421 default I fury_of_elune Fluffy_Pillow 82.5/100: 83% astral_power berserking, arcanic_pulsar(2), celestial_alignment, starlord(2), overwhelming_power(14), reckless_force_counter(12), battle_potion_of_intellect
3:09.300 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, starlord(2), overwhelming_power(13), reckless_force_counter(13), battle_potion_of_intellect
3:10.182 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), reckless_force_counter(13), battle_potion_of_intellect
3:10.936 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), overwhelming_power(12), reckless_force_counter(13), battle_potion_of_intellect
3:11.796 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(11), reckless_force_counter(13), conch_of_dark_whispers, battle_potion_of_intellect
3:12.551 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), starlord(3), overwhelming_power(10), reckless_force_counter(14), conch_of_dark_whispers, battle_potion_of_intellect
3:13.653 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), overwhelming_power(9), reckless_force_counter(14), conch_of_dark_whispers, battle_potion_of_intellect
3:14.523 default O moonfire Fluffy_Pillow 24.5/100: 25% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(8), reckless_force_counter(14), conch_of_dark_whispers, battle_potion_of_intellect
3:15.396 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(7), reckless_force_counter(14), conch_of_dark_whispers, battle_potion_of_intellect
3:16.150 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), starlord(3), overwhelming_power(6), reckless_force_counter(14), conch_of_dark_whispers, battle_potion_of_intellect
3:17.270 default N sunfire Fluffy_Pillow 59.5/100: 60% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(5), reckless_force_counter(15), conch_of_dark_whispers, battle_potion_of_intellect
3:18.151 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(4), reckless_force_counter(15), conch_of_dark_whispers, battle_potion_of_intellect
3:19.038 default P lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(3), reckless_force_counter(15), conch_of_dark_whispers, battle_potion_of_intellect
3:20.169 default Q solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(2), reckless_force_counter(15), conch_of_dark_whispers, battle_potion_of_intellect
3:21.063 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power, reckless_force_counter(15), conch_of_dark_whispers, battle_potion_of_intellect
3:22.136 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, reckless_force_counter(15), conch_of_dark_whispers, battle_potion_of_intellect
3:23.025 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, reckless_force_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:24.071 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), reckless_force_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:24.935 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), reckless_force_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:26.229 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), reckless_force_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:27.245 default L sunfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(18), battle_potion_of_intellect
3:28.234 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(19), battle_potion_of_intellect
3:29.683 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(19), battle_potion_of_intellect
3:31.130 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(19), battle_potion_of_intellect
3:32.577 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), reckless_force_counter(19), battle_potion_of_intellect
3:33.543 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), reckless_force_counter(19)
3:34.508 default P lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), reckless_force_counter(19)
3:35.956 default O moonfire Fluffy_Pillow 77.5/100: 78% astral_power reckless_force, arcanic_pulsar(8), starlord(3)
3:37.093 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power reckless_force, arcanic_pulsar(8), starlord(3)
3:38.230 default Q solar_wrath Fluffy_Pillow 90.0/100: 90% astral_power reckless_force, arcanic_pulsar(8), starlord(3)
3:39.369 default J cancel_buff Fluffy_Pillow 99.0/100: 99% astral_power reckless_force, arcanic_pulsar(8), starlord(3)
3:39.369 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power reckless_force, arcanic_pulsar(8)
3:40.610 default Q solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
3:41.500 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power celestial_alignment, lunar_empowerment, starlord, reckless_force_counter
3:42.547 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter
3:43.411 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), reckless_force_counter(3)
3:44.706 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), reckless_force_counter(4)
3:45.723 default L sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(4)
3:46.712 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(4)
3:48.162 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(4)
3:49.299 default P lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(4)
3:50.747 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(4)
3:52.194 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(5)
3:53.640 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), reckless_force_counter(5)
3:54.608 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), reckless_force_counter(6)
3:55.575 default P lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), reckless_force_counter(6)
3:57.023 default O moonfire Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(3), starlord(3), reckless_force_counter(6)
3:58.158 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(3), starlord(3), reckless_force_counter(6)
3:59.295 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(3), starlord(3), reckless_force_counter(6)
4:00.432 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(3), reckless_force_counter(7)
4:01.669 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(7)
4:02.872 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(8)
4:04.361 default N sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(10)
4:05.528 default G use_items Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(10)
4:05.528 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(10), ignition_mages_fuse
4:06.952 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(25), reckless_force_counter(10), ignition_mages_fuse
4:07.977 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(24), reckless_force_counter(10), ignition_mages_fuse
4:08.830 default I fury_of_elune Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), reckless_force_counter(11), ignition_mages_fuse
4:09.836 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), reckless_force_counter(11), ignition_mages_fuse(2)
4:11.073 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(3), starlord(3), overwhelming_power(24), reckless_force_counter(11), ignition_mages_fuse(2)
4:11.895 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(24), reckless_force_counter(11), ignition_mages_fuse(2)
4:12.860 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), reckless_force_counter(12), ignition_mages_fuse(2)
4:13.683 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), reckless_force_counter(13), ignition_mages_fuse(3)
4:14.877 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(21), reckless_force_counter(14), ignition_mages_fuse(3)
4:15.816 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20), reckless_force_counter(14), ignition_mages_fuse(3)
4:16.617 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), reckless_force_counter(14), ignition_mages_fuse(3)
4:17.820 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), reckless_force_counter(14), ignition_mages_fuse(4)
4:18.983 default O moonfire Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(17), reckless_force_counter(14), ignition_mages_fuse(4)
4:19.899 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(16), reckless_force_counter(14), ignition_mages_fuse(4)
4:20.681 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(8), solar_empowerment, overwhelming_power(15), reckless_force_counter(15), ignition_mages_fuse(4)
4:21.685 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(14), reckless_force_counter(15), ignition_mages_fuse(5)
4:22.508 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(13), reckless_force_counter(15), ignition_mages_fuse(5)
4:23.263 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(12), reckless_force_counter(15), ignition_mages_fuse(5)
4:24.091 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(11), reckless_force_counter(16), ignition_mages_fuse(5)
4:24.845 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(11), reckless_force_counter(17), ignition_mages_fuse(5)
4:25.871 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(10), reckless_force_counter(18)
4:26.704 default L sunfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(9), reckless_force_counter(18)
4:27.688 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(8), reckless_force_counter(18)
4:28.821 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(7), reckless_force_counter(18)
4:30.230 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5), reckless_force_counter(19)
4:31.650 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power reckless_force, arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4)
4:32.601 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power reckless_force, arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3)
4:34.033 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power reckless_force, arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power
4:35.165 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
4:36.612 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), reckless_force_counter
4:37.578 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), reckless_force_counter
4:39.026 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), starlord(3), reckless_force_counter
4:40.163 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(3), starlord(3), reckless_force_counter
4:41.300 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(3), reckless_force_counter
4:42.540 default O moonfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, reckless_force_counter
4:43.742 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(3)
4:45.276 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(25), reckless_force_counter(3)
4:46.376 default N sunfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24), reckless_force_counter(3)
4:47.449 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23), reckless_force_counter(3)
4:48.820 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22), reckless_force_counter(4)
4:49.737 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(21), reckless_force_counter(4)
4:50.657 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), starlord(2), torrent_of_elements, overwhelming_power(20), reckless_force_counter(4)
4:51.745 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), starlord(2), torrent_of_elements, overwhelming_power(19), reckless_force_counter(4)
4:52.835 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), reckless_force_counter(4)
4:54.193 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), reckless_force_counter(5)
4:55.104 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), reckless_force_counter(5)
4:56.019 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(14), reckless_force_counter(5)
4:57.098 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), overwhelming_power(24), reckless_force_counter(5)
4:58.426 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(25), reckless_force_counter(5)
4:59.465 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(24), reckless_force_counter(5)
5:00.508 default Q solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(23), reckless_force_counter(5)
5:01.554 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(6), overwhelming_power(22), reckless_force_counter(6)
5:02.698 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(21), reckless_force_counter(6)
5:03.810 default N sunfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20), reckless_force_counter(6)
5:04.898 default O moonfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), reckless_force_counter(7)
5:05.973 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), reckless_force_counter(7)
5:07.342 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(21), reckless_force_counter(8)
5:08.264 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), reckless_force_counter(8)
5:09.648 default I fury_of_elune Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), overwhelming_power(19), reckless_force_counter(8)
5:10.738 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment(3), starlord(2), overwhelming_power(18), reckless_force_counter(8)
5:11.671 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(2), overwhelming_power(17), reckless_force_counter(8)
5:12.771 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(16), reckless_force_counter(8)
5:13.564 default P lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), reckless_force_counter(9)
5:14.758 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), reckless_force_counter(9), conch_of_dark_whispers
5:15.698 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13), reckless_force_counter(9), conch_of_dark_whispers
5:16.502 default P lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12), reckless_force_counter(9), conch_of_dark_whispers
5:17.708 default L sunfire Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), reckless_force_counter(9), conch_of_dark_whispers
5:18.657 default P lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), reckless_force_counter(9), conch_of_dark_whispers
5:20.051 default Q solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar, solar_empowerment(3), starlord(3), overwhelming_power(8), reckless_force_counter(10), conch_of_dark_whispers
5:20.989 default J cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(8), reckless_force_counter(10), conch_of_dark_whispers
5:20.989 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar, solar_empowerment(2), overwhelming_power(8), reckless_force_counter(10), conch_of_dark_whispers
5:22.192 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(6), reckless_force_counter(10), conch_of_dark_whispers
5:23.192 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(5), reckless_force_counter(10), conch_of_dark_whispers
5:24.373 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(4), reckless_force_counter(11), conch_of_dark_whispers
5:25.351 default O moonfire Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(3), reckless_force_counter(12), conch_of_dark_whispers
5:26.506 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(2), reckless_force_counter(12), conch_of_dark_whispers
5:27.984 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power, reckless_force_counter(14), conch_of_dark_whispers
5:29.148 default Q solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(14)
5:30.114 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(14)
5:31.559 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(15)
5:33.008 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(15)
5:34.145 default Q solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(15)
5:35.112 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(15)
5:36.558 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(17)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="unbound force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

visions : 39737 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
39737.1 39737.1 33.6 / 0.085% 4265.9 / 10.7% 4792.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.3 8.2 Astral Power 0.00% 58.1 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
visions 39737
Fury of Elune 831 2.1% 5.4 60.43sec 46283 44800 Direct 128.5 1641 3275 1944 18.5%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.40 128.53 136.74 0.00 1.0333 0.3120 249802.86 249802.86 0.00 5178.33 44799.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.75 81.50% 1641.39 1472 2007 1640.81 1563 1797 171944 171944 0.00
crit 23.77 18.50% 3275.02 2944 4015 3273.11 2995 3720 77858 77858 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 301 (430) 0.8% (1.1%) 8.3 33.92sec 15672 0 Direct 8.3 9220 18453 10979 19.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.26 8.26 0.00 0.00 0.0000 0.0000 90705.59 90705.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 80.93% 9220.04 9012 9913 9219.58 9012 9913 61639 61639 0.00
crit 1.58 19.07% 18452.80 18024 19826 14760.96 0 19826 29066 29066 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 129 0.3% 8.3 33.92sec 4691 0 Direct 8.3 3952 7903 4691 18.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.26 8.26 0.00 0.00 0.0000 0.0000 38750.06 38750.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 81.30% 3952.02 3862 4248 3952.15 3862 4248 26541 26541 0.00
crit 1.54 18.70% 7903.49 7725 8497 6289.65 0 8497 12209 12209 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6074 15.3% 79.7 3.74sec 22904 17647 Direct 79.7 19301 38614 22903 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.73 79.73 0.00 0.00 1.2979 0.0000 1826145.01 1826145.01 0.00 17646.98 17646.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.86 81.35% 19301.45 10238 24458 19302.20 18585 20139 1251885 1251885 0.00
crit 14.87 18.65% 38614.30 20477 48917 38620.35 34710 43592 574260 574260 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3192 8.0% 14.1 21.52sec 68281 67662 Direct 14.1 3626 7247 4301 18.6%  
Periodic 224.4 3377 6752 4007 18.7% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.06 14.06 224.43 224.43 1.0092 1.3302 959784.51 959784.51 0.00 3069.04 67661.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.44 81.36% 3625.80 3313 4517 3626.85 3345 3916 41469 41469 0.00
crit 2.62 18.64% 7247.09 6626 9035 6864.26 0 9035 18985 18985 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.6 81.34% 3377.41 2 4206 3377.60 3289 3505 616567 616567 0.00
crit 41.9 18.66% 6751.89 116 8412 6752.12 6273 7270 282764 282764 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 3530 (5537) 8.9% (13.9%) 100.9 2.92sec 16514 18147 Direct 101.4 8816 17627 10472 18.8%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.85 101.38 0.00 0.00 0.9100 0.0000 1061640.90 1061640.90 0.00 18146.92 18146.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.34 81.21% 8816.21 8030 10949 8817.61 8519 9405 725932 725932 0.00
crit 19.05 18.79% 17626.94 16060 21898 17631.82 16060 19529 335709 335709 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2007 5.1% 76.3 3.85sec 7916 0 Direct 76.3 7917 0 7917 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.27 76.27 0.00 0.00 0.0000 0.0000 603811.16 603811.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.27 100.00% 7916.71 6023 16423 7917.38 6940 9283 603811 603811 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6925.97
  • base_dd_max:6925.97
  • base_dd_mult:1.00
 
Starsurge 13972 35.1% 62.4 4.86sec 67385 64603 Direct 62.1 56970 113877 67641 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.36 62.13 0.00 0.00 1.0431 0.0000 4202240.40 4202240.40 0.00 64603.14 64603.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.48 81.25% 56970.06 51872 70323 56967.69 55060 59483 2875811 2875811 0.00
crit 11.65 18.75% 113876.80 103744 140646 113874.02 103744 129270 1326429 1326429 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 6464 16.3% 99.2 2.90sec 19648 0 Direct 99.2 16563 33117 19648 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.22 99.22 0.00 0.00 0.0000 0.0000 1949343.17 1949343.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.73 81.37% 16563.30 16184 17803 16562.79 16184 17511 1337158 1337158 0.00
crit 18.49 18.63% 33117.01 32369 35606 33118.37 32369 35066 612185 612185 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3236 8.1% 17.9 16.77sec 54324 53427 Direct 17.9 4573 9144 5431 18.8%  
Periodic 223.7 3299 6594 3914 18.7% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.91 17.91 223.73 223.73 1.0168 1.3307 973012.88 973012.88 0.00 3079.88 53427.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.55 81.24% 4572.74 4154 5664 4572.20 4285 4964 66542 66542 0.00
crit 3.36 18.76% 9144.49 8309 11329 8877.72 0 11329 30725 30725 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.9 81.32% 3298.64 2 4107 3298.81 3212 3441 600152 600152 0.00
crit 41.8 18.68% 6593.91 28 8213 6594.48 6167 7117 275593 275593 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
visions
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Berserking 2.0 206.23sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.5 148.45sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.50 0.00 0.00 0.00 0.9074 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:144.965
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.8 43.9sec 4.9sec 92.91% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.60%
  • arcanic_pulsar_2:10.41%
  • arcanic_pulsar_3:11.42%
  • arcanic_pulsar_4:11.78%
  • arcanic_pulsar_5:13.68%
  • arcanic_pulsar_6:10.69%
  • arcanic_pulsar_7:11.21%
  • arcanic_pulsar_8:12.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 153.9sec 0.0sec 16.17% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 206.2sec 206.2sec 8.09% 8.10% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.48% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 7.5 0.0 42.5sec 42.5sec 28.34% 36.96% 0.0(0.0) 7.1

Buff details

  • buff initial source:visions
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:28.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.8sec 45.2sec 23.80% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:visions
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.4 0.0 60.4sec 60.4sec 14.21% 0.00% 85.3(85.3) 5.3

Buff details

  • buff initial source:visions
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.5 0.0 148.5sec 148.5sec 15.93% 0.00% 2.3(2.3) 2.3

Buff details

  • buff initial source:visions
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.27%
  • ignition_mages_fuse_2:3.23%
  • ignition_mages_fuse_3:3.18%
  • ignition_mages_fuse_4:3.15%
  • ignition_mages_fuse_5:3.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 39.5 43.2 7.6sec 3.6sec 78.98% 99.26% 2.0(2.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:38.62%
  • lunar_empowerment_2:26.96%
  • lunar_empowerment_3:13.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.7sec 34.1sec 47.93% 0.00% 3.5(48.3) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.43%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.58%
  • overwhelming_power_24:2.66%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 30.1 48.2 10.1sec 3.8sec 82.30% 75.33% 0.1(0.1) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:32.82%
  • solar_empowerment_2:35.93%
  • solar_empowerment_3:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 47.1 20.3sec 4.9sec 97.66% 92.82% 16.8(16.8) 11.9

Buff details

  • buff initial source:visions
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.36%
  • starlord_2:22.72%
  • starlord_3:59.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 60.7sec 45.7sec 23.70% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:visions
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.70%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:visions
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:visions
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:visions
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:visions
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
visions
starsurge Astral Power 62.4 2494.4 40.0 40.0 1684.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 101.86 814.54 (33.14%) 8.00 0.30 0.04%
celestial_alignment Astral Power 2.50 99.88 (4.06%) 40.00 0.00 0.00%
fury_of_elune Astral Power 85.30 213.25 (8.68%) 2.50 0.01 0.00%
sunfire Astral Power 17.91 53.73 (2.19%) 3.00 0.00 0.00%
moonfire Astral Power 14.06 42.17 (1.72%) 3.00 0.00 0.00%
lunar_strike Astral Power 79.73 956.41 (38.91%) 12.00 0.32 0.03%
natures_balance Astral Power 401.52 200.75 (8.17%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.44 77.30 (3.14%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.17 8.29
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.38 0.00 87.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data visions Fight Length
Count 3985
Mean 300.77
Minimum 240.06
Maximum 359.83
Spread ( max - min ) 119.77
Range [ ( max - min ) / 2 * 100% ] 19.91%
DPS
Sample Data visions Damage Per Second
Count 3985
Mean 39737.12
Minimum 36406.08
Maximum 43697.99
Spread ( max - min ) 7291.91
Range [ ( max - min ) / 2 * 100% ] 9.18%
Standard Deviation 1082.9818
5th Percentile 37966.02
95th Percentile 41514.70
( 95th Percentile - 5th Percentile ) 3548.68
Mean Distribution
Standard Deviation 17.1556
95.00% Confidence Intervall ( 39703.49 - 39770.74 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2854
0.1 Scale Factor Error with Delta=300 10013
0.05 Scale Factor Error with Delta=300 40049
0.01 Scale Factor Error with Delta=300 1001212
Priority Target DPS
Sample Data visions Priority Target Damage Per Second
Count 3985
Mean 39737.12
Minimum 36406.08
Maximum 43697.99
Spread ( max - min ) 7291.91
Range [ ( max - min ) / 2 * 100% ] 9.18%
Standard Deviation 1082.9818
5th Percentile 37966.02
95th Percentile 41514.70
( 95th Percentile - 5th Percentile ) 3548.68
Mean Distribution
Standard Deviation 17.1556
95.00% Confidence Intervall ( 39703.49 - 39770.74 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2854
0.1 Scale Factor Error with Delta=300 10013
0.05 Scale Factor Error with Delta=300 40049
0.01 Scale Factor Error with Delta=300 1001212
DPS(e)
Sample Data visions Damage Per Second (Effective)
Count 3985
Mean 39737.12
Minimum 36406.08
Maximum 43697.99
Spread ( max - min ) 7291.91
Range [ ( max - min ) / 2 * 100% ] 9.18%
Damage
Sample Data visions Damage
Count 3985
Mean 11955236.54
Minimum 9151552.64
Maximum 15081831.24
Spread ( max - min ) 5930278.60
Range [ ( max - min ) / 2 * 100% ] 24.80%
DTPS
Sample Data visions Damage Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data visions Healing Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data visions Healing Per Second (Effective)
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data visions Heal
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data visions Healing Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data visions Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data visionsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data visions Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.49 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.50 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.40 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.47 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 62.36 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.04 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.24 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.62 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.82 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 80.03 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 101.11 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.25 sunfire

Sample Sequence

012345678ACDKONPHFGIKQKQKQPQKQPQKNQOQPQKQPQKLPPPKQPQKQPQMQQQQQPKKNPPKQPQQKPQQOQPKNPQIKPKPQPQQPQJKNKOQPKPPKQPPQQNQQKKOPPQKQPPQKPNQQQQKPOQKIQPKQLPKQPQPQKQKQOPQPHEGKNQPKQPQPQRKQKQPKQOQPKQPQKQPLPPQQKPKQIPOKQPKNQPQQPKPKPQQQKFNQPKQPOQQQPKPQKPQNQKOPQQPQQQKPKINPKQPKQOPQQQPQKQKQPKLPPPKPOQQQQPKNKPPQQKPQQQHGOQJKNKQPKIQPKQPKQPQKQPQPQPKQKNOPPQKPPQKP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask visions 58.0/100: 58% astral_power
Pre precombat 1 food visions 58.0/100: 58% astral_power
Pre precombat 2 augmentation visions 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.237 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.161 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
0:03.085 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
0:04.265 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
0:05.069 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
0:05.069 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
0:05.069 default I fury_of_elune Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:05.824 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:06.578 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:07.332 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:08.088 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:08.844 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:09.599 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.354 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.109 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.865 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.619 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.374 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.128 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.881 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.634 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.388 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.144 default O moonfire Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.898 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.653 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.417 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.172 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.928 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.682 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.469 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.224 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(5)
0:23.977 default L sunfire Fluffy_Pillow 1.5/100: 2% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.731 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.619 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(18), conch_of_dark_whispers
0:26.693 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(17), conch_of_dark_whispers
0:27.769 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(16), conch_of_dark_whispers
0:28.617 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers
0:29.370 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), conch_of_dark_whispers
0:30.291 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers
0:31.046 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers
0:31.800 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers
0:32.553 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(11), conch_of_dark_whispers
0:33.486 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
0:34.240 default M moonfire Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(9), conch_of_dark_whispers
0:34.995 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(9), conch_of_dark_whispers
0:35.749 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(8), conch_of_dark_whispers
0:36.600 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(7), conch_of_dark_whispers
0:37.453 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(6), conch_of_dark_whispers
0:38.309 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(5)
0:39.168 default P lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(4)
0:40.264 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar, overwhelming_power(3)
0:41.206 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(2)
0:42.398 default N sunfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power
0:43.562 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:45.050 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
0:46.537 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2)
0:47.705 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
0:48.671 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
0:50.120 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3)
0:51.087 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3)
0:52.054 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3)
0:53.190 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
0:54.640 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements
0:55.607 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements
0:56.575 default O moonfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
0:57.712 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
0:58.848 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), torrent_of_elements
1:00.296 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(5), torrent_of_elements
1:01.534 default N sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:02.736 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:04.267 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), solar_empowerment, starlord, torrent_of_elements
1:05.287 default I fury_of_elune Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), starlord, torrent_of_elements
1:06.490 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(6), fury_of_elune, starlord, torrent_of_elements
1:07.691 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements
1:09.179 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment, starlord(2)
1:10.349 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3)
1:11.797 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(3)
1:12.763 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3)
1:14.212 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
1:15.179 default Q solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
1:16.315 default P lunar_strike Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), conch_of_dark_whispers
1:17.763 default Q solar_wrath Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
1:18.730 default J cancel_buff Fluffy_Pillow 97.0/100: 97% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), conch_of_dark_whispers
1:18.730 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power arcanic_pulsar(8), lunar_empowerment, conch_of_dark_whispers
1:19.967 default N sunfire Fluffy_Pillow 70.0/100: 70% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers
1:21.015 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers
1:22.060 default O moonfire Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:23.076 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:23.940 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers
1:25.237 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers
1:26.254 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:27.702 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:29.150 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:30.288 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:31.254 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:32.701 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:34.149 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3)
1:35.115 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
1:36.083 default N sunfire Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
1:37.220 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
1:38.188 default Q solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(3), starlord(3)
1:39.324 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(3)
1:40.562 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
1:41.766 default O moonfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:42.934 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:44.422 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
1:45.912 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2)
1:46.905 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
1:48.074 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:49.042 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:50.492 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:51.940 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers
1:52.824 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers
1:53.867 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers
1:55.199 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers
1:56.253 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
1:57.149 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers
1:58.051 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(18), conch_of_dark_whispers
1:59.116 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(17), conch_of_dark_whispers
2:00.184 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(7), overwhelming_power(16), conch_of_dark_whispers
2:01.353 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(15), conch_of_dark_whispers
2:02.802 default O moonfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, overwhelming_power(14)
2:03.944 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, overwhelming_power(13)
2:04.918 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(12)
2:06.067 default I fury_of_elune Fluffy_Pillow 15.0/100: 15% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(10)
2:07.047 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9)
2:07.883 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(9)
2:09.137 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(7)
2:10.129 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6)
2:10.951 default L sunfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6)
2:11.919 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5)
2:13.339 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3)
2:14.463 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(2)
2:15.422 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power
2:16.864 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
2:17.831 default P lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
2:19.277 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:20.245 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(2), solar_empowerment(2), torrent_of_elements
2:21.483 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements
2:22.505 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
2:23.708 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements
2:24.703 default O moonfire Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24)
2:25.776 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23)
2:27.146 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(21)
2:28.066 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20)
2:29.449 default H celestial_alignment Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19)
2:30.399 default E potion Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18)
2:30.399 default G use_items Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18), battle_potion_of_intellect
2:30.399 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse
2:31.313 default N sunfire Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse
2:32.206 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse
2:32.968 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse
2:34.111 default K starsurge Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse
2:35.013 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(2)
2:35.767 default P lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(2)
2:36.874 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), battle_potion_of_intellect, ignition_mages_fuse(2)
2:37.628 default P lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(11), battle_potion_of_intellect, ignition_mages_fuse(2)
2:38.743 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(6), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(10), battle_potion_of_intellect, ignition_mages_fuse(3)
2:39.497 default R sunfire Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(6), celestial_alignment, starlord(3), overwhelming_power(9), battle_potion_of_intellect, ignition_mages_fuse(3)
2:40.346 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(6), celestial_alignment, overwhelming_power(8), battle_potion_of_intellect, ignition_mages_fuse(3)
2:41.273 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(7), battle_potion_of_intellect, ignition_mages_fuse(3)
2:42.040 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord, overwhelming_power(6), battle_potion_of_intellect, ignition_mages_fuse(3)
2:42.947 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(6), battle_potion_of_intellect, ignition_mages_fuse(4)
2:43.702 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(4)
2:44.720 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(4)
2:45.524 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(4)
2:46.280 default O moonfire Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
2:47.065 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(5)
2:47.828 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(5)
2:48.794 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(5)
2:49.558 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(5)
2:50.313 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(5)
2:51.290 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(17), battle_potion_of_intellect
2:52.219 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(16), battle_potion_of_intellect
2:53.153 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15), battle_potion_of_intellect
2:53.949 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(15), battle_potion_of_intellect
2:55.140 default L sunfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(13), battle_potion_of_intellect
2:56.082 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(12)
2:57.467 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(11)
2:58.858 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(10)
2:59.953 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(9)
3:01.054 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(2), overwhelming_power(7)
3:02.260 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(6)
3:03.758 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(5)
3:04.940 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(4)
3:05.917 default I fury_of_elune Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(3)
3:07.227 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(4), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power
3:08.711 default O moonfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), fury_of_elune, solar_empowerment(2), starlord(2), torrent_of_elements
3:09.879 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), fury_of_elune, solar_empowerment(2), starlord(2), torrent_of_elements
3:11.048 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
3:12.014 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(5), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:13.460 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(5), fury_of_elune, solar_empowerment(2), starlord(3), torrent_of_elements
3:14.597 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
3:15.732 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
3:16.699 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:18.146 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements
3:19.112 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements
3:20.079 default P lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), torrent_of_elements
3:21.524 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(6), torrent_of_elements
3:22.764 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
3:24.295 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements
3:25.498 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
3:26.986 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements
3:27.981 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements
3:28.976 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), starlord(2), torrent_of_elements
3:30.144 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), starlord(2), torrent_of_elements
3:31.312 default F berserking Fluffy_Pillow 15.5/100: 16% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:31.312 default N sunfire Fluffy_Pillow 15.5/100: 16% astral_power berserking, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:32.212 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power berserking, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:32.977 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power berserking, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements
3:34.121 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power berserking, celestial_alignment, starlord(3), torrent_of_elements
3:35.021 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:35.784 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements
3:36.926 default O moonfire Fluffy_Pillow 22.5/100: 23% astral_power berserking, arcanic_pulsar, starlord(3), torrent_of_elements, conch_of_dark_whispers
3:37.959 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power berserking, arcanic_pulsar, starlord(3), torrent_of_elements, conch_of_dark_whispers
3:38.992 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power berserking, arcanic_pulsar, starlord(3), torrent_of_elements, conch_of_dark_whispers
3:40.028 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power berserking, arcanic_pulsar, starlord(3), torrent_of_elements, conch_of_dark_whispers
3:41.060 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power berserking, arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
3:42.377 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power berserking, arcanic_pulsar, torrent_of_elements, conch_of_dark_whispers
3:43.502 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
3:45.034 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord, conch_of_dark_whispers
3:46.056 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(2), solar_empowerment, starlord, conch_of_dark_whispers
3:47.258 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:48.747 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:49.741 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), conch_of_dark_whispers
3:50.910 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), conch_of_dark_whispers
3:51.905 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), starlord(2)
3:53.074 default O moonfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3)
3:54.212 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3)
3:55.660 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3)
3:56.626 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), starlord(3)
3:57.762 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3)
3:59.210 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), starlord(3)
4:00.347 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(24)
4:01.390 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(23)
4:02.437 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(4), overwhelming_power(22)
4:03.582 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(21)
4:05.002 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), solar_empowerment, starlord, overwhelming_power(19)
4:06.126 default I fury_of_elune Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18)
4:07.220 default N sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(17)
4:08.317 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(16)
4:09.721 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(2), starlord(2), overwhelming_power(15)
4:10.828 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14)
4:11.745 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13)
4:13.126 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(3), overwhelming_power(11)
4:14.217 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(10)
4:15.149 default O moonfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9)
4:16.250 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8)
4:17.655 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(7)
4:18.595 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(6)
4:19.539 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(5)
4:20.654 default P lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(4)
4:22.081 default Q solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(2), conch_of_dark_whispers
4:23.042 default K starsurge Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(8), overwhelming_power, conch_of_dark_whispers
4:24.277 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
4:25.166 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment(2), starlord, conch_of_dark_whispers
4:26.212 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers
4:27.077 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), conch_of_dark_whispers
4:28.369 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), conch_of_dark_whispers
4:29.387 default L sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers
4:30.295 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
4:31.627 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers
4:32.964 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers
4:34.305 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers
4:35.368 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers
4:36.726 default O moonfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
4:37.793 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers
4:38.704 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers
4:39.619 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(14), conch_of_dark_whispers
4:40.697 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(13), conch_of_dark_whispers
4:41.779 default P lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers
4:43.165 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(3), overwhelming_power(10), conch_of_dark_whispers
4:44.359 default N sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(9), conch_of_dark_whispers
4:45.521 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(8), conch_of_dark_whispers
4:46.689 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7), conch_of_dark_whispers
4:48.139 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(5), conch_of_dark_whispers
4:49.599 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(4), conch_of_dark_whispers
4:50.578 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), overwhelming_power(3), conch_of_dark_whispers
4:51.562 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), starlord(2), overwhelming_power(2)
4:52.720 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power
4:54.162 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), conch_of_dark_whispers
4:55.129 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), starlord(3), conch_of_dark_whispers
4:56.265 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), starlord(3), conch_of_dark_whispers
4:57.400 default H celestial_alignment Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers
4:58.387 default G use_items Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers
4:58.387 default O moonfire Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse
4:59.335 default Q solar_wrath Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse
5:00.282 default J cancel_buff Fluffy_Pillow 97.0/100: 97% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse
5:00.282 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, conch_of_dark_whispers, ignition_mages_fuse
5:01.314 default N sunfire Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers, ignition_mages_fuse
5:02.316 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers, ignition_mages_fuse
5:03.315 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(2)
5:04.109 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
5:05.298 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
5:06.232 default I fury_of_elune Fluffy_Pillow 16.0/100: 16% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
5:07.139 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
5:07.892 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
5:09.003 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
5:09.875 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(3)
5:10.630 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(4)
5:11.699 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), ignition_mages_fuse(4)
5:12.478 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), ignition_mages_fuse(4)
5:13.233 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), ignition_mages_fuse(4)
5:14.230 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), ignition_mages_fuse(4)
5:14.985 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), ignition_mages_fuse(5)
5:15.744 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), ignition_mages_fuse(5)
5:16.498 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(20), ignition_mages_fuse(5)
5:17.471 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), ignition_mages_fuse(5)
5:18.235 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), ignition_mages_fuse(5)
5:19.213 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17)
5:20.002 default P lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16)
5:21.189 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(3), celestial_alignment, torrent_of_elements, overwhelming_power(15)
5:22.209 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(14)
5:23.055 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, overwhelming_power(13)
5:24.054 default N sunfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(12)
5:25.175 default O moonfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(24)
5:26.247 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(23)
5:27.620 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(22)
5:28.994 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(21)
5:29.914 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(20)
5:31.002 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18)
5:32.359 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17)
5:33.720 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(16)
5:34.633 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15)
5:35.710 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 5.88% 5.88% 500
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="visions"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

worldvein : 40977 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
40976.6 40976.6 38.2 / 0.093% 4794.7 / 11.7% 4960.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.2 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
worldvein 40977
Fury of Elune 941 2.3% 5.4 60.71sec 52489 53172 Direct 133.5 1788 3570 2115 18.4%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 133.45 143.64 0.00 0.9872 0.2959 282292.44 282292.44 0.00 5904.96 53172.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 108.93 81.63% 1787.73 1457 2133 1788.73 1692 1923 194741 194741 0.00
crit 24.52 18.37% 3570.48 2915 4267 3572.57 3213 4008 87551 87551 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 299 (427) 0.7% (1.0%) 8.3 33.53sec 15493 0 Direct 8.3 9132 18244 10834 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.28 8.28 0.00 0.00 0.0000 0.0000 89711.68 89711.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.74 81.33% 9131.86 8921 9813 9130.20 0 9813 61506 61506 0.00
crit 1.55 18.67% 18243.73 17842 19626 14514.75 0 19626 28206 28206 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 128 0.3% 8.3 33.53sec 4660 0 Direct 8.3 3914 7816 4660 19.1%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.28 8.28 0.00 0.00 0.0000 0.0000 38589.66 38589.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 80.89% 3914.03 3823 4206 3914.25 3823 4206 26218 26218 0.00
crit 1.58 19.11% 7815.75 7646 8411 6275.77 0 8411 12372 12372 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6436 15.7% 79.8 3.74sec 24247 18644 Direct 79.8 20439 40860 24247 18.6%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.76 79.76 0.00 0.00 1.3005 0.0000 1933897.21 1933897.21 0.00 18643.75 18643.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.89 81.35% 20438.52 10335 25993 20445.93 19785 21423 1326202 1326202 0.00
crit 14.87 18.65% 40860.40 21476 51987 40870.48 36833 46067 607695 607695 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3375 8.2% 14.1 21.40sec 71915 71691 Direct 14.1 3862 7746 4577 18.4%  
Periodic 224.2 3567 7135 4234 18.7% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.10 14.10 224.17 224.17 1.0031 1.3318 1013644.50 1013644.50 0.00 3241.57 71691.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.50 81.61% 3861.81 3280 4801 3864.11 3587 4205 44421 44421 0.00
crit 2.59 18.39% 7746.32 6689 9602 7317.58 0 9602 20084 20084 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.3 81.30% 3566.91 4 4470 3568.37 3472 3708 650112 650112 0.00
crit 41.9 18.70% 7134.52 8 8940 7136.48 6646 7761 299027 299027 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 3742 (5848) 9.1% (14.3%) 101.5 2.90sec 17310 18956 Direct 102.0 9287 18569 11020 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.50 102.01 0.00 0.00 0.9132 0.0000 1124135.06 1124135.06 0.00 18955.53 18955.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.97 81.33% 9287.48 7949 11636 9291.91 8996 9672 770547 770547 0.00
crit 19.04 18.67% 18569.28 15898 23272 18578.23 17298 20457 353588 353588 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2107 5.1% 75.8 3.87sec 8350 0 Direct 75.8 8350 0 8350 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.79 75.79 0.00 0.00 0.0000 0.0000 632853.37 632853.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.79 100.00% 8350.13 5962 17454 8355.19 7322 9953 632853 632853 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:12868.61
  • base_dd_max:12868.61
  • base_dd_mult:1.00
 
Starsurge 14614 35.7% 62.0 4.88sec 70803 67982 Direct 61.8 59834 119720 71033 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.99 61.78 0.00 0.00 1.0415 0.0000 4388909.04 4388909.04 0.00 67981.86 67981.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.23 81.30% 59833.74 51347 74359 59856.99 57191 62732 3005333 3005333 0.00
crit 11.56 18.70% 119720.28 104566 148718 119731.22 109725 136808 1383576 1383576 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 5919 14.4% 91.1 3.08sec 19409 0 Direct 91.1 16388 32790 19408 18.4%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.12 91.12 0.00 0.00 0.0000 0.0000 1768547.96 1768547.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.34 81.59% 16387.87 16021 17623 16387.89 16021 17222 1218338 1218338 0.00
crit 16.78 18.41% 32790.13 32042 35246 32790.38 32042 34955 550210 550210 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3416 8.3% 17.9 16.72sec 57229 56192 Direct 17.9 4830 9681 5735 18.7%  
Periodic 223.5 3485 6963 4132 18.6% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.93 17.93 223.46 223.46 1.0185 1.3323 1026239.80 1026239.80 0.00 3247.90 56192.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.59 81.35% 4830.33 4194 6020 4831.31 4494 5226 70464 70464 0.00
crit 3.34 18.65% 9681.05 8387 12040 9439.96 0 12040 32379 32379 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.9 81.39% 3484.93 15 4364 3486.37 3394 3642 633847 633847 0.00
crit 41.6 18.61% 6963.39 9 8729 6966.09 6590 7481 289549 289549 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
worldvein
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.39sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.17sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9067 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.5 43.9sec 4.9sec 92.64% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:12.24%
  • arcanic_pulsar_2:10.23%
  • arcanic_pulsar_3:11.10%
  • arcanic_pulsar_4:10.62%
  • arcanic_pulsar_5:13.06%
  • arcanic_pulsar_6:11.52%
  • arcanic_pulsar_7:11.17%
  • arcanic_pulsar_8:12.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.6sec 0.0sec 16.17% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.09% 7.53% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.48% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 38.0sec 38.0sec 25.97% 35.88% 0.0(0.0) 8.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.7sec 23.65% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.4 0.0 60.7sec 60.7sec 14.15% 0.00% 85.0(85.0) 5.2

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:14.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.24% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 89.2 0.0 150.4sec 3.3sec 98.23% 0.00% 75.5(79.8) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:229.17

Stack Uptimes

  • lifeblood_1:1.46%
  • lifeblood_2:2.17%
  • lifeblood_3:6.26%
  • lifeblood_4:88.34%

Trigger Attempt Success

  • trigger_pct:94.08%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 40.8 41.8 7.5sec 3.6sec 77.92% 99.76% 1.8(1.8) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:38.53%
  • lunar_empowerment_2:26.14%
  • lunar_empowerment_3:13.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.4 64.3sec 34.0sec 47.82% 0.00% 3.4(48.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.22%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.58%
  • overwhelming_power_24:2.65%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 29.4 48.5 10.3sec 3.9sec 82.42% 74.43% 0.1(0.1) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:33.54%
  • solar_empowerment_2:36.02%
  • solar_empowerment_3:12.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.7 20.3sec 4.9sec 97.65% 92.84% 16.5(16.5) 12.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.73%
  • starlord_2:22.29%
  • starlord_3:59.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.6sec 23.71% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.71%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
worldvein
starsurge Astral Power 62.0 2479.5 40.0 40.0 1770.1
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 102.50 819.62 (33.56%) 8.00 0.39 0.05%
celestial_alignment Astral Power 2.00 80.00 (3.28%) 40.00 0.00 0.00%
fury_of_elune Astral Power 84.96 212.41 (8.70%) 2.50 0.00 0.00%
sunfire Astral Power 17.93 53.80 (2.20%) 3.00 0.00 0.00%
moonfire Astral Power 14.09 42.28 (1.73%) 3.00 0.00 0.00%
lunar_strike Astral Power 79.76 956.73 (39.18%) 12.00 0.37 0.04%
natures_balance Astral Power 401.52 200.75 (8.22%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.37 76.42 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.12 8.24
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.80 0.00 66.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data worldvein Fight Length
Count 3985
Mean 300.77
Minimum 240.06
Maximum 359.83
Spread ( max - min ) 119.77
Range [ ( max - min ) / 2 * 100% ] 19.91%
DPS
Sample Data worldvein Damage Per Second
Count 3985
Mean 40976.60
Minimum 37522.28
Maximum 45405.62
Spread ( max - min ) 7883.33
Range [ ( max - min ) / 2 * 100% ] 9.62%
Standard Deviation 1231.1076
5th Percentile 39047.40
95th Percentile 43049.66
( 95th Percentile - 5th Percentile ) 4002.26
Mean Distribution
Standard Deviation 19.5021
95.00% Confidence Intervall ( 40938.37 - 41014.82 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3468
0.1 Scale Factor Error with Delta=300 12939
0.05 Scale Factor Error with Delta=300 51754
0.01 Scale Factor Error with Delta=300 1293826
Priority Target DPS
Sample Data worldvein Priority Target Damage Per Second
Count 3985
Mean 40976.60
Minimum 37522.28
Maximum 45405.62
Spread ( max - min ) 7883.33
Range [ ( max - min ) / 2 * 100% ] 9.62%
Standard Deviation 1231.1076
5th Percentile 39047.40
95th Percentile 43049.66
( 95th Percentile - 5th Percentile ) 4002.26
Mean Distribution
Standard Deviation 19.5021
95.00% Confidence Intervall ( 40938.37 - 41014.82 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3468
0.1 Scale Factor Error with Delta=300 12939
0.05 Scale Factor Error with Delta=300 51754
0.01 Scale Factor Error with Delta=300 1293826
DPS(e)
Sample Data worldvein Damage Per Second (Effective)
Count 3985
Mean 40976.60
Minimum 37522.28
Maximum 45405.62
Spread ( max - min ) 7883.33
Range [ ( max - min ) / 2 * 100% ] 9.62%
Damage
Sample Data worldvein Damage
Count 3985
Mean 12298820.71
Minimum 9533605.71
Maximum 14942712.34
Spread ( max - min ) 5409106.63
Range [ ( max - min ) / 2 * 100% ] 21.99%
DTPS
Sample Data worldvein Damage Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data worldvein Healing Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data worldvein Healing Per Second (Effective)
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data worldvein Heal
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data worldvein Healing Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data worldvein Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data worldveinTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data worldvein Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.38 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.37 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.99 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.01 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.90 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.77 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.20 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 80.10 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 101.76 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.16 sunfire

Sample Sequence

012345678ACDKONPHFGIKQKQPKQPKQPKNQPOQPQKQPKLPPQPKQPKQPQPKPQQOQKPNQQKPPQKPQQQPQNKOPIKPQKPQQQPQNJKQKQPKMPPKQPPKQPNQPKPQQOKPQQQKPNPQQQKPQKGIQPKQPKNOPQQQQPQKKPPKQPQONKPQQQQQPQKKPPQQKNQPKQMPQQQQQKPHEFIKNKQPQKQOQPKQPQPQKQKNPPKQPQKQPOPPQQQKKNPPPKQPQKQPOQNPQKPGIQKQPKQPPQQQNOKQPQKQKLPKPPQQKPQQQPOQPKKNPPQKPQQQKPQQNOQKIQKQPKPPKQPPNQPQOKPKPQQKPQP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask worldvein 58.0/100: 58% astral_power
Pre precombat 1 food worldvein 58.0/100: 58% astral_power
Pre precombat 2 augmentation worldvein 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.165 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.089 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, lifeblood, battle_potion_of_intellect
0:04.268 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, lifeblood, battle_potion_of_intellect
0:05.073 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, lifeblood, battle_potion_of_intellect
0:05.073 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, lifeblood, battle_potion_of_intellect
0:05.073 default I fury_of_elune Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, lifeblood, battle_potion_of_intellect, ignition_mages_fuse
0:05.827 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord, lifeblood, battle_potion_of_intellect, ignition_mages_fuse
0:06.581 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood, battle_potion_of_intellect, ignition_mages_fuse
0:07.334 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), lifeblood, battle_potion_of_intellect, ignition_mages_fuse
0:08.089 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.844 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.690 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.443 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.196 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.005 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.759 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.513 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.290 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.044 default N sunfire Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.799 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.551 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.330 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.085 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.840 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.665 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.420 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.175 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.930 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.769 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord, lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.523 default L sunfire Fluffy_Pillow 1.5/100: 2% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.278 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.216 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), lifeblood(4), conch_of_dark_whispers
0:26.363 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(2), lifeblood(4), conch_of_dark_whispers
0:27.125 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(2), lifeblood(4), conch_of_dark_whispers
0:28.270 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(8), starlord(2), lifeblood(4), conch_of_dark_whispers
0:29.168 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
0:29.923 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
0:30.893 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
0:31.655 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
0:32.411 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
0:33.382 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
0:34.143 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
0:35.113 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, arcanic_pulsar, starlord(3), lifeblood(4), conch_of_dark_whispers
0:35.990 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
0:37.104 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(2), solar_empowerment, starlord(3), lifeblood(4)
0:37.858 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar(2), starlord(3), lifeblood(4)
0:38.734 default O moonfire Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar(2), starlord(3), lifeblood(4)
0:39.609 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, arcanic_pulsar(2), starlord(3), lifeblood(4)
0:40.485 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(2), lifeblood(4)
0:41.440 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, lifeblood(4)
0:42.971 default N sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, lifeblood(4)
0:44.173 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, lifeblood(4)
0:45.195 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), solar_empowerment, starlord, lifeblood(4)
0:46.217 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment, starlord, lifeblood(3)
0:47.420 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood(3)
0:48.909 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), lifeblood(4)
0:50.398 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), lifeblood(4)
0:51.392 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), starlord(2), lifeblood(4)
0:52.559 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4)
0:54.007 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), lifeblood(4)
0:54.974 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), starlord(3), lifeblood(4)
0:56.112 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), starlord(3), lifeblood(4)
0:57.247 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), lifeblood(4)
0:58.696 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(5), starlord(3), lifeblood(4)
0:59.832 default N sunfire Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(5), starlord(3), lifeblood(4)
1:00.969 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(5), lifeblood(4)
1:02.208 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, lifeblood(4)
1:03.411 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, lifeblood(4)
1:04.943 default I fury_of_elune Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), solar_empowerment, starlord, lifeblood(4)
1:06.275 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment, starlord, lifeblood(4)
1:07.477 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4)
1:08.966 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment(2), starlord(2), lifeblood(4)
1:09.959 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), fury_of_elune, solar_empowerment, starlord(2), lifeblood(4)
1:11.126 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
1:12.572 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), fury_of_elune, solar_empowerment(2), starlord(3), lifeblood(4)
1:13.539 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(25), lifeblood(3)
1:14.422 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(24), lifeblood(4)
1:15.466 default P lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(23), lifeblood(4)
1:16.798 default Q solar_wrath Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(22), lifeblood(4)
1:17.848 default N sunfire Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(21), lifeblood(4)
1:18.901 default J cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(20), lifeblood(4)
1:18.901 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), overwhelming_power(20), lifeblood(4)
1:20.053 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18), lifeblood(4)
1:20.885 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(18), lifeblood(4)
1:21.865 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(25), lifeblood(4)
1:22.659 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(24), lifeblood(4)
1:23.846 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23), lifeblood(4)
1:24.784 default M moonfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), lifeblood(4)
1:25.697 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), lifeblood(4)
1:27.038 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), lifeblood(4)
1:28.390 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), lifeblood(4)
1:29.453 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(17), lifeblood(4)
1:30.360 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), lifeblood(4)
1:31.728 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), lifeblood(4)
1:33.098 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), lifeblood(4)
1:34.182 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(12), lifeblood(4)
1:35.106 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), lifeblood(4)
1:36.496 default N sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(10), lifeblood(4)
1:37.591 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(9), lifeblood(4)
1:38.524 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(8), lifeblood(4)
1:39.929 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(4), solar_empowerment, overwhelming_power(7), lifeblood(4)
1:41.135 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(5), lifeblood(4)
1:42.640 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, overwhelming_power(4), lifeblood(4)
1:43.648 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), solar_empowerment, starlord, overwhelming_power(3), lifeblood(4)
1:44.661 default O moonfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), starlord, overwhelming_power(2), lifeblood(4)
1:45.855 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), starlord, overwhelming_power, lifeblood(4)
1:47.051 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), lifeblood(3)
1:48.540 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), lifeblood(3)
1:49.533 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), starlord(2), lifeblood(4)
1:50.701 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), starlord(2), torrent_of_elements, lifeblood(4)
1:51.871 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(2), torrent_of_elements, lifeblood(4)
1:53.041 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
1:54.486 default N sunfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
1:55.623 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
1:57.071 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
1:58.037 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
1:59.002 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, lifeblood(4)
2:00.138 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(7), torrent_of_elements, lifeblood(4)
2:01.377 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, lifeblood(4)
2:02.910 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, lifeblood(4)
2:03.932 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), starlord, torrent_of_elements, lifeblood(4)
2:05.135 default G use_items Fluffy_Pillow 15.0/100: 15% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(24), lifeblood(4)
2:05.135 default I fury_of_elune Fluffy_Pillow 15.0/100: 15% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(24), lifeblood(4), ignition_mages_fuse
2:06.030 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(23), lifeblood(4), ignition_mages_fuse
2:06.795 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, starlord(2), overwhelming_power(23), lifeblood(4), ignition_mages_fuse
2:07.940 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power celestial_alignment, fury_of_elune, starlord(2), overwhelming_power(22), lifeblood(4), ignition_mages_fuse
2:08.842 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21), lifeblood(4), ignition_mages_fuse
2:09.596 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), overwhelming_power(20), lifeblood(4), ignition_mages_fuse(2)
2:10.677 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, fury_of_elune, starlord(3), overwhelming_power(19), lifeblood(4), ignition_mages_fuse(2)
2:11.656 default N sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), lifeblood(4), ignition_mages_fuse(2)
2:12.640 default O moonfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), lifeblood(4), ignition_mages_fuse(2)
2:13.627 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(16), lifeblood(4), ignition_mages_fuse(3)
2:14.841 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(15), lifeblood(4), ignition_mages_fuse(3)
2:15.653 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(14), lifeblood(4), ignition_mages_fuse(3)
2:16.613 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(13), lifeblood(4), ignition_mages_fuse(3)
2:17.573 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(12), lifeblood(4), ignition_mages_fuse(4)
2:18.505 default P lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(11), lifeblood(4), ignition_mages_fuse(4)
2:19.693 default Q solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(10), lifeblood(4), ignition_mages_fuse(4)
2:20.489 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(2), overwhelming_power(9), lifeblood(4), ignition_mages_fuse(4)
2:21.512 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(8), lifeblood(4), ignition_mages_fuse(5)
2:22.474 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7), lifeblood(4), ignition_mages_fuse(5)
2:23.666 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(6), lifeblood(4), ignition_mages_fuse(5)
2:24.862 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5), lifeblood(4), ignition_mages_fuse(5)
2:25.805 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(4), lifeblood(4)
2:26.758 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3), lifeblood(4)
2:28.189 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), lifeblood(4)
2:29.072 default O moonfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), lifeblood(4)
2:30.114 default N sunfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), lifeblood(4)
2:31.162 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), lifeblood(4)
2:32.212 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), lifeblood(4)
2:33.554 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), lifeblood(4)
2:34.455 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), lifeblood(4)
2:35.357 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(18), lifeblood(4)
2:36.422 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(17), lifeblood(3)
2:37.491 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(16), lifeblood(4)
2:38.564 default P lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), overwhelming_power(15), lifeblood(4)
2:39.934 default Q solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(14), lifeblood(4)
2:41.013 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(6), overwhelming_power(12), lifeblood(4)
2:42.198 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11), lifeblood(4)
2:43.354 default P lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10), lifeblood(4), conch_of_dark_whispers
2:44.787 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9), lifeblood(4), conch_of_dark_whispers
2:46.226 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(7), lifeblood(4), conch_of_dark_whispers
2:47.193 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(6), lifeblood(4), conch_of_dark_whispers
2:48.165 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), starlord(2), overwhelming_power(5), lifeblood(4), conch_of_dark_whispers
2:49.313 default N sunfire Fluffy_Pillow 16.5/100: 17% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(4), lifeblood(4), conch_of_dark_whispers
2:50.287 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(3), lifeblood(4), conch_of_dark_whispers
2:51.119 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(2), lifeblood(4), conch_of_dark_whispers
2:52.371 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power celestial_alignment, starlord(3), overwhelming_power(25), lifeblood(4), conch_of_dark_whispers
2:53.275 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), lifeblood(4), conch_of_dark_whispers
2:54.046 default M moonfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), lifeblood(4), conch_of_dark_whispers
2:54.956 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(23), lifeblood(4), conch_of_dark_whispers
2:56.289 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, starlord(3), overwhelming_power(21), lifeblood(4), conch_of_dark_whispers
2:57.344 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, starlord(3), overwhelming_power(20), lifeblood(4), conch_of_dark_whispers
2:58.402 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, starlord(3), overwhelming_power(19), lifeblood(4)
2:59.463 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, starlord(3), overwhelming_power(18), lifeblood(4)
3:00.528 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, starlord(3), overwhelming_power(17), lifeblood(4)
3:01.598 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar, overwhelming_power(16), lifeblood(4)
3:02.766 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(15), lifeblood(4)
3:04.213 default H celestial_alignment Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), solar_empowerment, starlord, overwhelming_power(13), lifeblood(4)
3:05.267 default E potion Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, overwhelming_power(12), lifeblood(4)
3:05.267 default F berserking Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, overwhelming_power(12), lifeblood(4), battle_potion_of_intellect
3:05.267 default I fury_of_elune Fluffy_Pillow 85.5/100: 86% astral_power berserking, arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, overwhelming_power(12), lifeblood(4), battle_potion_of_intellect
3:06.175 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power berserking, arcanic_pulsar(2), celestial_alignment, fury_of_elune, solar_empowerment, starlord, overwhelming_power(11), lifeblood(3), battle_potion_of_intellect
3:07.089 default N sunfire Fluffy_Pillow 54.0/100: 54% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(10), lifeblood(3), battle_potion_of_intellect
3:07.979 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power berserking, arcanic_pulsar(3), celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(10), lifeblood(3), battle_potion_of_intellect
3:08.870 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(9), lifeblood(3), battle_potion_of_intellect
3:09.626 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(8), lifeblood(3), battle_potion_of_intellect
3:10.738 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), lifeblood(4), battle_potion_of_intellect
3:11.492 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power berserking, arcanic_pulsar(4), celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(6), lifeblood(4), battle_potion_of_intellect
3:12.372 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(5), lifeblood(4), battle_potion_of_intellect
3:13.127 default O moonfire Fluffy_Pillow 47.0/100: 47% astral_power berserking, arcanic_pulsar(5), celestial_alignment, fury_of_elune, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(4), lifeblood(4), battle_potion_of_intellect
3:14.014 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(3), lifeblood(4), battle_potion_of_intellect
3:14.771 default P lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(3), lifeblood(4), battle_potion_of_intellect
3:15.902 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(2), lifeblood(4), battle_potion_of_intellect
3:16.796 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power, lifeblood(4), battle_potion_of_intellect
3:17.556 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), lifeblood(4), battle_potion_of_intellect
3:18.818 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect
3:19.658 default P lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect
3:20.917 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect
3:21.904 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, lifeblood(4), battle_potion_of_intellect
3:22.982 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(4), battle_potion_of_intellect
3:23.870 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, lifeblood(4), battle_potion_of_intellect
3:24.917 default N sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), lifeblood(4), battle_potion_of_intellect
3:26.085 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(23), lifeblood(4), battle_potion_of_intellect
3:27.455 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(22), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:28.830 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:29.913 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:30.697 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), lifeblood(4), conch_of_dark_whispers
3:31.872 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), lifeblood(4), conch_of_dark_whispers
3:32.659 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), lifeblood(4), conch_of_dark_whispers
3:33.589 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16), lifeblood(4), conch_of_dark_whispers
3:34.384 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15), lifeblood(4), conch_of_dark_whispers
3:35.574 default O moonfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14), lifeblood(4), conch_of_dark_whispers
3:36.653 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13), lifeblood(4), conch_of_dark_whispers
3:38.033 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), lifeblood(4), conch_of_dark_whispers
3:39.423 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(10), lifeblood(4), conch_of_dark_whispers
3:40.355 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(9), lifeblood(4), conch_of_dark_whispers
3:41.289 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar, starlord(3), overwhelming_power(25), lifeblood(4), conch_of_dark_whispers
3:42.327 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar, lunar_empowerment, overwhelming_power(24), lifeblood(4), conch_of_dark_whispers
3:43.463 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), lifeblood(4)
3:44.570 default N sunfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(22), lifeblood(4)
3:45.649 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(21), lifeblood(4)
3:47.029 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), lifeblood(4)
3:48.418 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18), lifeblood(4)
3:49.813 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17), lifeblood(4)
3:50.912 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(16), lifeblood(4)
3:51.823 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), lifeblood(4)
3:53.195 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13), lifeblood(4)
3:54.116 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), lifeblood(4)
3:55.203 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(11), lifeblood(4)
3:56.131 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), lifeblood(4)
3:57.526 default O moonfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), lifeblood(4)
3:58.625 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), lifeblood(4)
3:59.565 default N sunfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(7), lifeblood(4)
4:00.674 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), lifeblood(4)
4:02.090 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), lifeblood(4)
4:03.040 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(5), solar_empowerment, torrent_of_elements, overwhelming_power(3), lifeblood(4)
4:04.264 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(2), lifeblood(4)
4:05.784 default G use_items Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord, overwhelming_power(24), lifeblood(4)
4:05.784 default I fury_of_elune Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord, overwhelming_power(24), lifeblood(4), ignition_mages_fuse
4:06.846 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(3), starlord, overwhelming_power(23), lifeblood(4), ignition_mages_fuse
4:07.750 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(6), fury_of_elune, solar_empowerment(2), starlord, overwhelming_power(22), lifeblood(4), ignition_mages_fuse
4:08.817 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(21), lifeblood(4), ignition_mages_fuse
4:09.703 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20), lifeblood(4), ignition_mages_fuse
4:11.032 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18), lifeblood(4), ignition_mages_fuse(2)
4:12.046 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17), lifeblood(4), ignition_mages_fuse(2)
4:12.884 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(8), fury_of_elune, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17), lifeblood(4), ignition_mages_fuse(2)
4:14.140 default P lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), lifeblood(4), ignition_mages_fuse(3)
4:15.357 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(14), lifeblood(4), ignition_mages_fuse(3)
4:16.172 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(13), lifeblood(4), ignition_mages_fuse(3)
4:16.990 default Q solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(13), lifeblood(4), ignition_mages_fuse(3)
4:17.953 default N sunfire Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(12), lifeblood(4), ignition_mages_fuse(4)
4:18.884 default O moonfire Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(11), lifeblood(4), ignition_mages_fuse(4)
4:19.819 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(10), lifeblood(4), ignition_mages_fuse(4)
4:20.756 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(9), lifeblood(4), ignition_mages_fuse(4)
4:21.510 default P lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(8), lifeblood(4), ignition_mages_fuse(4)
4:22.554 default Q solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power celestial_alignment, starlord(3), overwhelming_power(7), lifeblood(4), ignition_mages_fuse(5)
4:23.349 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power celestial_alignment, overwhelming_power(6), lifeblood(4), ignition_mages_fuse(5)
4:24.216 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(5), lifeblood(4), ignition_mages_fuse(5)
4:24.971 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, overwhelming_power(5), lifeblood(4), ignition_mages_fuse(5)
4:25.815 default L sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(4), lifeblood(4)
4:26.816 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(3), lifeblood(4)
4:28.287 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power, lifeblood(4)
4:29.451 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4)
4:30.898 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
4:32.346 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), lifeblood(4)
4:33.311 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), lifeblood(4)
4:34.278 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(25), lifeblood(3)
4:35.318 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), lifeblood(4)
4:36.645 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(23), lifeblood(4)
4:37.535 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(22), lifeblood(4)
4:38.588 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(21), lifeblood(4)
4:39.640 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3), overwhelming_power(20), lifeblood(4)
4:40.987 default O moonfire Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(19), lifeblood(3)
4:42.048 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(17), lifeblood(4)
4:43.116 default P lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3), overwhelming_power(16), lifeblood(4)
4:44.481 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(4), overwhelming_power(15), lifeblood(4)
4:45.653 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), lifeblood(4)
4:46.797 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), lifeblood(4)
4:47.913 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), lifeblood(4)
4:49.338 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(10), lifeblood(4)
4:50.772 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(9), lifeblood(4)
4:51.734 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(8), lifeblood(4)
4:52.867 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), lifeblood(4)
4:54.277 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(5), lifeblood(4)
4:55.225 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(4), lifeblood(4)
4:56.176 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(3), lifeblood(4)
4:57.301 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(2), lifeblood(4)
4:58.430 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, lifeblood(4)
4:59.873 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
5:00.839 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, lifeblood(4)
5:01.975 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, lifeblood(4)
5:03.112 default O moonfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, lifeblood(4)
5:04.251 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, lifeblood(4)
5:05.388 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), torrent_of_elements, lifeblood(4)
5:06.629 default I fury_of_elune Fluffy_Pillow 24.0/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, lifeblood(4)
5:07.675 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, lifeblood(4)
5:08.564 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power celestial_alignment, fury_of_elune, lunar_empowerment, starlord, torrent_of_elements, lifeblood(4)
5:09.612 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, lifeblood(4)
5:10.476 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4)
5:11.771 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(2), torrent_of_elements, lifeblood(4)
5:12.786 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
5:14.232 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), fury_of_elune, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
5:15.678 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), lifeblood(4)
5:16.814 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4)
5:17.782 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(3)
5:19.229 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
5:20.677 default N sunfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), lifeblood(4)
5:21.814 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), lifeblood(4)
5:22.780 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4)
5:24.227 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(24), lifeblood(4)
5:25.114 default O moonfire Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(23), lifeblood(4)
5:26.161 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(3), overwhelming_power(22), lifeblood(4)
5:27.305 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(21), lifeblood(4)
5:28.726 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), solar_empowerment, starlord, overwhelming_power(20), lifeblood(4)
5:29.843 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19), lifeblood(4)
5:31.233 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), overwhelming_power(17), lifeblood(4)
5:32.166 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(16), lifeblood(4)
5:33.105 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), overwhelming_power(15), lifeblood(4)
5:34.213 default P lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), lifeblood(4)
5:35.587 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), lifeblood(4)
5:36.510 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12), lifeblood(4)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="worldvein"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

Simulation & Raid Information

Iterations: 3991
Threads: 6
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.8 )

Performance:

Total Events Processed: 134759468
Max Event Queue: 466
Sim Seconds: 1200376
CPU Seconds: 199.2969
Physical Seconds: 38.1139
Speed Up: 6023

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
base base augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
base base berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.61sec 0 300.77sec
base base celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.40sec 0 300.77sec
base base flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
base base food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
base base fury_of_elune 202770 265502 883 26.63 1680 3354 5.4 133.5 18.4% 0.0% 0.0% 0.0% 60.77sec 265502 300.77sec
base base heed_my_call 271685 89838 299 1.65 9126 18245 8.3 8.3 19.1% 0.0% 0.0% 0.0% 33.28sec 89838 300.77sec
base base heed_my_call_aoe 271686 38376 128 1.65 3911 7820 8.3 8.3 18.7% 0.0% 0.0% 0.0% 33.28sec 38376 300.77sec
base base lunar_strike 194153 1796598 5973 15.89 19021 38029 79.7 79.7 18.6% 0.0% 0.0% 0.0% 3.74sec 1796598 300.77sec
base base moonfire 8921 60403 201 2.81 3611 7222 14.1 14.1 18.6% 0.0% 0.0% 0.0% 21.39sec 944538 300.77sec
base base moonfire ticks -8921 884135 2947 44.84 3325 6645 14.1 224.2 18.6% 0.0% 0.0% 0.0% 21.39sec 944538 300.77sec
base base moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
base base potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
base base solar_wrath 190984 1047925 3484 20.38 8651 17306 101.6 102.2 18.6% 0.0% 0.0% 0.0% 2.90sec 1047925 300.77sec
base base solar_empowerment 279729 589976 1962 15.14 7774 0 75.9 75.9 0.0% 0.0% 0.0% 0.0% 3.86sec 589976 300.77sec
base base starsurge 78674 4113881 13678 12.32 56132 112216 62.0 61.8 18.7% 0.0% 0.0% 0.0% 4.88sec 4113881 300.77sec
base base streaking_stars 272873 1771363 5889 18.18 16385 32767 91.2 91.2 18.6% 0.0% 0.0% 0.0% 3.08sec 1771363 300.77sec
base base sunfire 93402 95902 319 3.58 4509 9025 17.9 17.9 18.6% 0.0% 0.0% 0.0% 16.72sec 956747 300.77sec
base base sunfire ticks -93402 860845 2869 44.70 3247 6488 17.9 223.5 18.7% 0.0% 0.0% 0.0% 16.72sec 956747 300.77sec
blood of the enemy blood of the enemy augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
blood of the enemy blood of the enemy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.86sec 0 300.77sec
blood of the enemy blood of the enemy celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.65sec 0 300.77sec
blood of the enemy blood of the enemy flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
blood of the enemy blood of the enemy food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
blood of the enemy blood of the enemy fury_of_elune 202770 271759 904 26.85 1678 3344 5.4 134.6 20.5% 0.0% 0.0% 0.0% 60.81sec 271759 300.77sec
blood of the enemy blood of the enemy heed_my_call 271685 91933 306 1.66 9127 18246 8.3 8.3 21.2% 0.0% 0.0% 0.0% 32.80sec 91933 300.77sec
blood of the enemy blood of the enemy heed_my_call_aoe 271686 39156 130 1.66 3911 7821 8.3 8.3 20.4% 0.0% 0.0% 0.0% 32.80sec 39156 300.77sec
blood of the enemy blood of the enemy lunar_strike 194153 1848792 6147 16.02 19033 38008 80.3 80.3 21.0% 0.0% 0.0% 0.0% 3.70sec 1848792 300.77sec
blood of the enemy blood of the enemy moonfire 8921 61406 204 2.81 3609 7208 14.1 14.1 20.8% 0.0% 0.0% 0.0% 21.44sec 970841 300.77sec
blood of the enemy blood of the enemy moonfire ticks -8921 909434 3031 45.23 3325 6644 14.1 226.1 21.0% 0.0% 0.0% 0.0% 21.44sec 970841 300.77sec
blood of the enemy blood of the enemy moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
blood of the enemy blood of the enemy potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
blood of the enemy blood of the enemy solar_wrath 190984 1082555 3599 20.63 8655 17295 102.9 103.4 21.0% 0.0% 0.0% 0.0% 2.86sec 1082555 300.77sec
blood of the enemy blood of the enemy solar_empowerment 279729 606060 2015 15.23 7939 0 76.3 76.3 0.0% 0.0% 0.0% 0.0% 3.84sec 606060 300.77sec
blood of the enemy blood of the enemy starsurge 78674 4224274 14045 12.41 56144 112128 62.4 62.2 21.0% 0.0% 0.0% 0.0% 4.85sec 4224274 300.77sec
blood of the enemy blood of the enemy streaking_stars 272873 1819319 6049 18.32 16388 32773 91.8 91.8 20.9% 0.0% 0.0% 0.0% 3.06sec 1819319 300.77sec
blood of the enemy blood of the enemy sunfire 93402 96927 322 3.56 4504 9009 17.8 17.8 20.8% 0.0% 0.0% 0.0% 16.84sec 981789 300.77sec
blood of the enemy blood of the enemy sunfire ticks -93402 884862 2950 45.07 3248 6488 17.8 225.3 21.0% 0.0% 0.0% 0.0% 16.84sec 981789 300.77sec
conflict+strife conflict+strife augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
conflict+strife conflict+strife berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.33sec 0 300.77sec
conflict+strife conflict+strife celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.12sec 0 300.77sec
conflict+strife conflict+strife flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
conflict+strife conflict+strife food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
conflict+strife conflict+strife fury_of_elune 202770 274774 914 26.63 1739 3471 5.4 133.5 18.4% 0.0% 0.0% 0.0% 60.71sec 274774 300.77sec
conflict+strife conflict+strife heed_my_call 271685 92955 309 1.65 9499 19007 8.3 8.3 18.5% 0.0% 0.0% 0.0% 33.47sec 92955 300.77sec
conflict+strife conflict+strife heed_my_call_aoe 271686 39953 133 1.65 4072 8143 8.3 8.3 18.9% 0.0% 0.0% 0.0% 33.47sec 39953 300.77sec
conflict+strife conflict+strife lunar_strike 194153 1872242 6225 15.88 19798 39574 79.6 79.6 18.8% 0.0% 0.0% 0.0% 3.75sec 1872242 300.77sec
conflict+strife conflict+strife moonfire 8921 62737 209 2.81 3752 7500 14.1 14.1 18.7% 0.0% 0.0% 0.0% 21.39sec 982419 300.77sec
conflict+strife conflict+strife moonfire ticks -8921 919682 3066 44.84 3457 6910 14.1 224.2 18.7% 0.0% 0.0% 0.0% 21.39sec 982419 300.77sec
conflict+strife conflict+strife moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
conflict+strife conflict+strife potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
conflict+strife conflict+strife solar_wrath 190984 1091876 3630 20.40 8999 17991 101.8 102.3 18.7% 0.0% 0.0% 0.0% 2.89sec 1091876 300.77sec
conflict+strife conflict+strife solar_empowerment 279729 614314 2042 15.14 8092 0 75.9 75.9 0.0% 0.0% 0.0% 0.0% 3.86sec 614314 300.77sec
conflict+strife conflict+strife starsurge 78674 4278619 14226 12.33 58360 116639 62.0 61.8 18.7% 0.0% 0.0% 0.0% 4.88sec 4278619 300.77sec
conflict+strife conflict+strife streaking_stars 272873 1831094 6088 18.17 16967 33957 91.1 91.1 18.5% 0.0% 0.0% 0.0% 3.08sec 1831094 300.77sec
conflict+strife conflict+strife sunfire 93402 99839 332 3.58 4688 9368 17.9 17.9 18.8% 0.0% 0.0% 0.0% 16.71sec 995209 300.77sec
conflict+strife conflict+strife sunfire ticks -93402 895370 2985 44.70 3376 6752 17.9 223.5 18.7% 0.0% 0.0% 0.0% 16.71sec 995209 300.77sec
crucible of flame crucible of flame ancient_flame ticks -295367 462210 1541 18.16 4284 8605 25.2 90.8 18.6% 0.0% 0.0% 0.0% 11.67sec 462210 300.77sec
crucible of flame crucible of flame augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
crucible of flame crucible of flame berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.46sec 0 300.77sec
crucible of flame crucible of flame celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.25sec 0 300.77sec
crucible of flame crucible of flame flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
crucible of flame crucible of flame food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
crucible of flame crucible of flame fury_of_elune 202770 265836 884 26.62 1681 3356 5.4 133.4 18.6% 0.0% 0.0% 0.0% 60.74sec 265836 300.77sec
crucible of flame crucible of flame heed_my_call 271685 89449 297 1.65 9126 18284 8.3 8.3 18.6% 0.0% 0.0% 0.0% 33.35sec 89449 300.77sec
crucible of flame crucible of flame heed_my_call_aoe 271686 38322 127 1.65 3913 7822 8.3 8.3 18.6% 0.0% 0.0% 0.0% 33.35sec 38322 300.77sec
crucible of flame crucible of flame lunar_strike 194153 1798181 5979 15.89 19018 38046 79.6 79.6 18.7% 0.0% 0.0% 0.0% 3.74sec 1798181 300.77sec
crucible of flame crucible of flame moonfire 8921 60152 200 2.81 3611 7211 14.1 14.1 18.2% 0.0% 0.0% 0.0% 21.42sec 944283 300.77sec
crucible of flame crucible of flame moonfire ticks -8921 884132 2947 44.84 3324 6647 14.1 224.2 18.6% 0.0% 0.0% 0.0% 21.42sec 944283 300.77sec
crucible of flame crucible of flame moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
crucible of flame crucible of flame potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
crucible of flame crucible of flame solar_wrath 190984 1048831 3487 20.38 8651 17282 101.7 102.2 18.7% 0.0% 0.0% 0.0% 2.89sec 1048831 300.77sec
crucible of flame crucible of flame solar_empowerment 279729 590211 1962 15.13 7780 0 75.9 75.9 0.0% 0.0% 0.0% 0.0% 3.86sec 590211 300.77sec
crucible of flame crucible of flame starsurge 78674 4113523 13677 12.32 56129 112228 62.0 61.8 18.6% 0.0% 0.0% 0.0% 4.88sec 4113523 300.77sec
crucible of flame crucible of flame streaking_stars 272873 1769191 5882 18.17 16386 32781 91.1 91.1 18.6% 0.0% 0.0% 0.0% 3.08sec 1769191 300.77sec
crucible of flame crucible of flame sunfire 93402 95829 319 3.57 4509 9019 17.9 17.9 18.6% 0.0% 0.0% 0.0% 16.75sec 956485 300.77sec
crucible of flame crucible of flame sunfire ticks -93402 860656 2869 44.70 3247 6486 17.9 223.5 18.6% 0.0% 0.0% 0.0% 16.75sec 956485 300.77sec
focusing iris focusing iris augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
focusing iris focusing iris berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.78sec 0 300.77sec
focusing iris focusing iris celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.59sec 0 300.77sec
focusing iris focusing iris flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
focusing iris focusing iris food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
focusing iris focusing iris fury_of_elune 202770 277918 924 27.76 1685 3369 5.4 139.1 18.5% 0.0% 0.0% 0.0% 60.80sec 277918 300.77sec
focusing iris focusing iris heed_my_call 271685 92625 308 1.70 9127 18244 8.5 8.5 18.8% 0.0% 0.0% 0.0% 32.47sec 92625 300.77sec
focusing iris focusing iris heed_my_call_aoe 271686 39717 132 1.70 3912 7820 8.5 8.5 18.8% 0.0% 0.0% 0.0% 32.47sec 39717 300.77sec
focusing iris focusing iris lunar_strike 194153 1872414 6225 16.53 19049 38104 82.9 82.9 18.6% 0.0% 0.0% 0.0% 3.59sec 1872414 300.77sec
focusing iris focusing iris moonfire 8921 60439 201 2.83 3583 7166 14.2 14.2 18.7% 0.0% 0.0% 0.0% 21.36sec 983479 300.77sec
focusing iris focusing iris moonfire ticks -8921 923040 3077 46.76 3328 6653 14.2 233.8 18.6% 0.0% 0.0% 0.0% 21.36sec 983479 300.77sec
focusing iris focusing iris moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
focusing iris focusing iris potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
focusing iris focusing iris solar_wrath 190984 1105927 3677 21.49 8657 17294 107.2 107.7 18.6% 0.0% 0.0% 0.0% 2.74sec 1105927 300.77sec
focusing iris focusing iris solar_empowerment 279729 612966 2038 15.69 7793 0 78.7 78.7 0.0% 0.0% 0.0% 0.0% 3.73sec 612966 300.77sec
focusing iris focusing iris starsurge 78674 4260297 14165 12.75 56214 112303 64.1 63.9 18.6% 0.0% 0.0% 0.0% 4.71sec 4260297 300.77sec
focusing iris focusing iris streaking_stars 272873 1833222 6095 18.81 16390 32782 94.3 94.3 18.6% 0.0% 0.0% 0.0% 3.00sec 1833222 300.77sec
focusing iris focusing iris sunfire 93402 93321 310 3.50 4482 8962 17.6 17.6 18.6% 0.0% 0.0% 0.0% 17.14sec 991255 300.77sec
focusing iris focusing iris sunfire ticks -93402 897934 2993 46.60 3250 6495 17.6 233.0 18.6% 0.0% 0.0% 0.0% 17.14sec 991255 300.77sec
life-force life-force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
life-force life-force azerite_spike 295835 265173 882 3.34 13337 26672 16.8 16.8 18.7% 0.0% 0.0% 0.0% 17.24sec 265173 300.77sec
life-force life-force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.47sec 0 300.77sec
life-force life-force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.27sec 0 300.77sec
life-force life-force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
life-force life-force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
life-force life-force fury_of_elune 202770 269997 898 26.63 1707 3411 5.4 133.5 18.5% 0.0% 0.0% 0.0% 60.74sec 269997 300.77sec
life-force life-force heed_my_call 271685 90319 300 1.64 9261 18508 8.2 8.2 18.4% 0.0% 0.0% 0.0% 33.21sec 90319 300.77sec
life-force life-force heed_my_call_aoe 271686 38760 129 1.64 3968 7937 8.2 8.2 18.6% 0.0% 0.0% 0.0% 33.21sec 38760 300.77sec
life-force life-force lunar_strike 194153 1827474 6076 15.91 19302 38540 79.8 79.8 18.8% 0.0% 0.0% 0.0% 3.74sec 1827474 300.77sec
life-force life-force moonfire 8921 61370 204 2.81 3667 7329 14.1 14.1 18.9% 0.0% 0.0% 0.0% 21.41sec 958750 300.77sec
life-force life-force moonfire ticks -8921 897380 2991 44.84 3374 6745 14.1 224.2 18.6% 0.0% 0.0% 0.0% 21.41sec 958750 300.77sec
life-force life-force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
life-force life-force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
life-force life-force solar_wrath 190984 1062970 3534 20.36 8780 17550 101.6 102.1 18.6% 0.0% 0.0% 0.0% 2.90sec 1062970 300.77sec
life-force life-force solar_empowerment 279729 598743 1991 15.13 7896 0 75.8 75.8 0.0% 0.0% 0.0% 0.0% 3.87sec 598743 300.77sec
life-force life-force starsurge 78674 4174567 13880 12.33 57019 113740 62.0 61.8 18.6% 0.0% 0.0% 0.0% 4.88sec 4174567 300.77sec
life-force life-force streaking_stars 272873 1800701 5987 18.17 16665 33334 91.1 91.1 18.6% 0.0% 0.0% 0.0% 3.08sec 1800701 300.77sec
life-force life-force sunfire 93402 97442 324 3.58 4577 9173 17.9 17.9 18.7% 0.0% 0.0% 0.0% 16.76sec 971085 300.77sec
life-force life-force sunfire ticks -93402 873644 2912 44.70 3295 6585 17.9 223.5 18.7% 0.0% 0.0% 0.0% 16.76sec 971085 300.77sec
lucid dreams lucid dreams augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
lucid dreams lucid dreams berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.70sec 0 300.77sec
lucid dreams lucid dreams celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.50sec 0 300.77sec
lucid dreams lucid dreams flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
lucid dreams lucid dreams food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
lucid dreams lucid dreams fury_of_elune 202770 269219 895 26.73 1698 3387 5.4 134.0 18.4% 0.0% 0.0% 0.0% 60.79sec 269219 300.77sec
lucid dreams lucid dreams heed_my_call 271685 90494 301 1.65 9215 18448 8.3 8.3 18.5% 0.0% 0.0% 0.0% 33.18sec 90494 300.77sec
lucid dreams lucid dreams heed_my_call_aoe 271686 38845 129 1.65 3949 7904 8.3 8.3 18.7% 0.0% 0.0% 0.0% 33.18sec 38845 300.77sec
lucid dreams lucid dreams lunar_strike 194153 1855999 6171 16.24 19204 38393 81.4 81.4 18.7% 0.0% 0.0% 0.0% 3.66sec 1855999 300.77sec
lucid dreams lucid dreams moonfire 8921 61475 204 2.85 3625 7258 14.3 14.3 18.7% 0.0% 0.0% 0.0% 21.13sec 957909 300.77sec
lucid dreams lucid dreams moonfire ticks -8921 896434 2988 44.92 3364 6725 14.3 224.6 18.7% 0.0% 0.0% 0.0% 21.13sec 957909 300.77sec
lucid dreams lucid dreams moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
lucid dreams lucid dreams potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
lucid dreams lucid dreams solar_wrath 190984 1005452 3343 19.28 8771 17538 96.1 96.7 18.6% 0.0% 0.0% 0.0% 3.07sec 1005452 300.77sec
lucid dreams lucid dreams solar_empowerment 279729 626567 2083 15.89 7866 0 79.6 79.6 0.0% 0.0% 0.0% 0.0% 3.69sec 626567 300.77sec
lucid dreams lucid dreams starsurge 78674 4458006 14822 13.21 56731 113412 66.5 66.2 18.7% 0.0% 0.0% 0.0% 4.56sec 4458006 300.77sec
lucid dreams lucid dreams streaking_stars 272873 1839285 6115 18.65 16589 33188 93.5 93.5 18.6% 0.0% 0.0% 0.0% 3.04sec 1839285 300.77sec
lucid dreams lucid dreams sunfire 93402 96060 319 3.55 4551 9091 17.8 17.8 18.7% 0.0% 0.0% 0.0% 16.90sec 968776 300.77sec
lucid dreams lucid dreams sunfire ticks -93402 872716 2909 44.77 3285 6565 17.8 223.8 18.7% 0.0% 0.0% 0.0% 16.90sec 968776 300.77sec
purification protocol purification protocol augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
purification protocol purification protocol berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.55sec 0 300.77sec
purification protocol purification protocol celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.34sec 0 300.77sec
purification protocol purification protocol flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
purification protocol purification protocol food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
purification protocol purification protocol fury_of_elune 202770 265343 882 26.61 1680 3356 5.4 133.4 18.4% 0.0% 0.0% 0.0% 60.74sec 265343 300.77sec
purification protocol purification protocol heed_my_call 271685 89508 298 1.65 9128 18267 8.3 8.3 18.7% 0.0% 0.0% 0.0% 33.54sec 89508 300.77sec
purification protocol purification protocol heed_my_call_aoe 271686 38453 128 1.65 3912 7829 8.3 8.3 19.0% 0.0% 0.0% 0.0% 33.54sec 38453 300.77sec
purification protocol purification protocol lunar_strike 194153 1796862 5974 15.89 19020 38038 79.6 79.6 18.6% 0.0% 0.0% 0.0% 3.74sec 1796862 300.77sec
purification protocol purification protocol moonfire 8921 60466 201 2.81 3610 7224 14.1 14.1 18.8% 0.0% 0.0% 0.0% 21.39sec 944852 300.77sec
purification protocol purification protocol moonfire ticks -8921 884386 2948 44.84 3324 6646 14.1 224.2 18.7% 0.0% 0.0% 0.0% 21.39sec 944852 300.77sec
purification protocol purification protocol moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
purification protocol purification protocol potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
purification protocol purification protocol purification_protocol 295293 223271 742 3.34 11226 22454 16.7 16.7 18.8% 0.0% 0.0% 0.0% 17.31sec 223271 300.77sec
purification protocol purification protocol solar_wrath 190984 1047128 3481 20.37 8653 17296 101.6 102.1 18.5% 0.0% 0.0% 0.0% 2.90sec 1047128 300.77sec
purification protocol purification protocol solar_empowerment 279729 589014 1958 15.12 7771 0 75.8 75.8 0.0% 0.0% 0.0% 0.0% 3.87sec 589014 300.77sec
purification protocol purification protocol starsurge 78674 4109372 13663 12.32 56142 112197 62.0 61.8 18.5% 0.0% 0.0% 0.0% 4.88sec 4109372 300.77sec
purification protocol purification protocol streaking_stars 272873 1770374 5886 18.18 16389 32773 91.1 91.1 18.5% 0.0% 0.0% 0.0% 3.08sec 1770374 300.77sec
purification protocol purification protocol sunfire 93402 96157 320 3.58 4509 9027 18.0 18.0 18.8% 0.0% 0.0% 0.0% 16.72sec 956927 300.77sec
purification protocol purification protocol sunfire ticks -93402 860770 2869 44.69 3247 6489 18.0 223.5 18.7% 0.0% 0.0% 0.0% 16.72sec 956927 300.77sec
ripple in space ripple in space augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
ripple in space ripple in space berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.60sec 0 300.77sec
ripple in space ripple in space celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.39sec 0 300.77sec
ripple in space ripple in space flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
ripple in space ripple in space food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
ripple in space ripple in space fury_of_elune 202770 277145 921 26.64 1751 3495 5.4 133.6 18.6% 0.0% 0.0% 0.0% 60.76sec 277145 300.77sec
ripple in space ripple in space heed_my_call 271685 89292 297 1.65 9130 18246 8.3 8.3 18.5% 0.0% 0.0% 0.0% 33.44sec 89292 300.77sec
ripple in space ripple in space heed_my_call_aoe 271686 38459 128 1.65 3912 7827 8.3 8.3 19.0% 0.0% 0.0% 0.0% 33.44sec 38459 300.77sec
ripple in space ripple in space lunar_strike 194153 1877297 6242 15.90 19845 39687 79.7 79.7 18.7% 0.0% 0.0% 0.0% 3.74sec 1877297 300.77sec
ripple in space ripple in space moonfire 8921 63017 210 2.81 3768 7524 14.1 14.1 18.7% 0.0% 0.0% 0.0% 21.38sec 985780 300.77sec
ripple in space ripple in space moonfire ticks -8921 922763 3076 44.84 3470 6935 14.1 224.2 18.6% 0.0% 0.0% 0.0% 21.38sec 985780 300.77sec
ripple in space ripple in space moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
ripple in space ripple in space potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
ripple in space ripple in space solar_wrath 190984 1093741 3636 20.37 9027 18042 101.6 102.1 18.7% 0.0% 0.0% 0.0% 2.90sec 1093741 300.77sec
ripple in space ripple in space solar_empowerment 279729 616881 2051 15.15 8125 0 75.9 75.9 0.0% 0.0% 0.0% 0.0% 3.87sec 616881 300.77sec
ripple in space ripple in space starsurge 78674 4278946 14227 12.33 58378 116681 62.0 61.8 18.7% 0.0% 0.0% 0.0% 4.88sec 4278946 300.77sec
ripple in space ripple in space streaking_stars 272873 1770361 5886 18.18 16389 32787 91.1 91.1 18.5% 0.0% 0.0% 0.0% 3.08sec 1770361 300.77sec
ripple in space ripple in space sunfire 93402 99895 332 3.58 4704 9404 17.9 17.9 18.5% 0.0% 0.0% 0.0% 16.73sec 998783 300.77sec
ripple in space ripple in space sunfire ticks -93402 898888 2996 44.70 3389 6776 17.9 223.5 18.7% 0.0% 0.0% 0.0% 16.73sec 998783 300.77sec
unbound force unbound force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
unbound force unbound force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.52sec 0 300.77sec
unbound force unbound force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.31sec 0 300.77sec
unbound force unbound force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
unbound force unbound force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
unbound force unbound force fury_of_elune 202770 274840 914 26.61 1684 3330 5.4 133.4 22.9% 0.0% 0.0% 0.0% 60.74sec 274840 300.77sec
unbound force unbound force heed_my_call 271685 92294 307 1.65 9127 18253 8.3 8.3 22.3% 0.0% 0.0% 0.0% 32.95sec 92294 300.77sec
unbound force unbound force heed_my_call_aoe 271686 39642 132 1.65 3911 7826 8.3 8.3 22.6% 0.0% 0.0% 0.0% 32.95sec 39642 300.77sec
unbound force unbound force lunar_strike 194153 1846988 6141 15.88 19030 37972 79.6 79.6 22.0% 0.0% 0.0% 0.0% 3.75sec 1846988 300.77sec
unbound force unbound force moonfire 8921 62148 207 2.81 3612 7218 14.1 14.1 22.0% 0.0% 0.0% 0.0% 21.40sec 972247 300.77sec
unbound force unbound force moonfire ticks -8921 910100 3034 44.85 3327 6633 14.1 224.2 22.1% 0.0% 0.0% 0.0% 21.40sec 972247 300.77sec
unbound force unbound force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
unbound force unbound force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
unbound force unbound force solar_wrath 190984 1077520 3583 20.39 8655 17271 101.7 102.2 21.9% 0.0% 0.0% 0.0% 2.89sec 1077520 300.77sec
unbound force unbound force solar_empowerment 279729 606411 2016 15.14 7993 0 75.9 75.9 0.0% 0.0% 0.0% 0.0% 3.86sec 606411 300.77sec
unbound force unbound force starsurge 78674 4243232 14108 12.33 56181 111990 62.0 61.8 22.4% 0.0% 0.0% 0.0% 4.88sec 4243232 300.77sec
unbound force unbound force streaking_stars 272873 1816871 6041 18.17 16388 32788 91.1 91.1 21.7% 0.0% 0.0% 0.0% 3.07sec 1816871 300.77sec
unbound force unbound force sunfire 93402 98816 329 3.58 4510 9009 17.9 17.9 22.2% 0.0% 0.0% 0.0% 16.73sec 984025 300.77sec
unbound force unbound force sunfire ticks -93402 885209 2951 44.70 3249 6478 17.9 223.5 22.0% 0.0% 0.0% 0.0% 16.73sec 984025 300.77sec
visions visions augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
visions visions berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 206.23sec 0 300.77sec
visions visions celestial_alignment 194223 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 148.45sec 0 300.77sec
visions visions flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
visions visions food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
visions visions fury_of_elune 202770 249803 831 25.64 1641 3275 5.4 128.5 18.5% 0.0% 0.0% 0.0% 60.43sec 249803 300.77sec
visions visions heed_my_call 271685 90706 302 1.65 9220 18453 8.3 8.3 19.1% 0.0% 0.0% 0.0% 33.92sec 90706 300.77sec
visions visions heed_my_call_aoe 271686 38750 129 1.65 3952 7903 8.3 8.3 18.7% 0.0% 0.0% 0.0% 33.92sec 38750 300.77sec
visions visions lunar_strike 194153 1826145 6072 15.91 19301 38614 79.7 79.7 18.7% 0.0% 0.0% 0.0% 3.74sec 1826145 300.77sec
visions visions moonfire 8921 60454 201 2.80 3626 7247 14.1 14.1 18.6% 0.0% 0.0% 0.0% 21.52sec 959785 300.77sec
visions visions moonfire ticks -8921 899331 2998 44.89 3377 6752 14.1 224.4 18.7% 0.0% 0.0% 0.0% 21.52sec 959785 300.77sec
visions visions moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
visions visions potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
visions visions solar_wrath 190984 1061641 3530 20.22 8816 17627 100.9 101.4 18.8% 0.0% 0.0% 0.0% 2.92sec 1061641 300.77sec
visions visions solar_empowerment 279729 603811 2008 15.22 7917 0 76.3 76.3 0.0% 0.0% 0.0% 0.0% 3.85sec 603811 300.77sec
visions visions starsurge 78674 4202240 13972 12.39 56970 113877 62.4 62.1 18.7% 0.0% 0.0% 0.0% 4.86sec 4202240 300.77sec
visions visions streaking_stars 272873 1949343 6481 19.79 16563 33117 99.2 99.2 18.6% 0.0% 0.0% 0.0% 2.90sec 1949343 300.77sec
visions visions sunfire 93402 97267 323 3.57 4573 9144 17.9 17.9 18.8% 0.0% 0.0% 0.0% 16.77sec 973013 300.77sec
visions visions sunfire ticks -93402 875746 2919 44.75 3299 6594 17.9 223.7 18.7% 0.0% 0.0% 0.0% 16.77sec 973013 300.77sec
worldvein worldvein augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
worldvein worldvein berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.39sec 0 300.77sec
worldvein worldvein celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.17sec 0 300.77sec
worldvein worldvein flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
worldvein worldvein food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
worldvein worldvein fury_of_elune 202770 282292 939 26.62 1788 3570 5.4 133.5 18.4% 0.0% 0.0% 0.0% 60.71sec 282292 300.77sec
worldvein worldvein heed_my_call 271685 89712 298 1.65 9132 18244 8.3 8.3 18.7% 0.0% 0.0% 0.0% 33.53sec 89712 300.77sec
worldvein worldvein heed_my_call_aoe 271686 38590 128 1.65 3914 7816 8.3 8.3 19.1% 0.0% 0.0% 0.0% 33.53sec 38590 300.77sec
worldvein worldvein lunar_strike 194153 1933897 6430 15.91 20439 40860 79.8 79.8 18.6% 0.0% 0.0% 0.0% 3.74sec 1933897 300.77sec
worldvein worldvein moonfire 8921 64505 214 2.81 3862 7746 14.1 14.1 18.4% 0.0% 0.0% 0.0% 21.40sec 1013644 300.77sec
worldvein worldvein moonfire ticks -8921 949140 3164 44.83 3567 7135 14.1 224.2 18.7% 0.0% 0.0% 0.0% 21.40sec 1013644 300.77sec
worldvein worldvein moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
worldvein worldvein potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.77sec
worldvein worldvein solar_wrath 190984 1124135 3738 20.35 9287 18569 101.5 102.0 18.7% 0.0% 0.0% 0.0% 2.90sec 1124135 300.77sec
worldvein worldvein solar_empowerment 279729 632853 2104 15.12 8350 0 75.8 75.8 0.0% 0.0% 0.0% 0.0% 3.87sec 632853 300.77sec
worldvein worldvein starsurge 78674 4388909 14592 12.33 59834 119720 62.0 61.8 18.7% 0.0% 0.0% 0.0% 4.88sec 4388909 300.77sec
worldvein worldvein streaking_stars 272873 1768548 5880 18.18 16388 32790 91.1 91.1 18.4% 0.0% 0.0% 0.0% 3.08sec 1768548 300.77sec
worldvein worldvein sunfire 93402 102844 342 3.58 4830 9681 17.9 17.9 18.7% 0.0% 0.0% 0.0% 16.72sec 1026240 300.77sec
worldvein worldvein sunfire ticks -93402 923396 3078 44.69 3485 6963 17.9 223.5 18.6% 0.0% 0.0% 0.0% 16.72sec 1026240 300.77sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
447396.8 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 13.77% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:13.78%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.70% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.49% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.49%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.11% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.11%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.36% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.36%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.79% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.79%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.12% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.12%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 12.07% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:12.07%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.77% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.77%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.82% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.82%

Trigger Attempt Success

  • trigger_pct:100.00%
Condensed Life-Force (condensed_life_force) 12.5 4.2 23.6sec 17.3sec 28.93% 0.00% 4.2(4.2) 12.2

Buff details

  • buff initial source:life-force
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:28.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 447396.84
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 3985
Mean 300.77
Minimum 240.06
Maximum 359.83
Spread ( max - min ) 119.77
Range [ ( max - min ) / 2 * 100% ] 19.91%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 3985
Mean 479723.56
Minimum 459179.06
Maximum 509315.75
Spread ( max - min ) 50136.68
Range [ ( max - min ) / 2 * 100% ] 5.23%
Standard Deviation 9036.8390
5th Percentile 465783.52
95th Percentile 494046.67
( 95th Percentile - 5th Percentile ) 28263.16
Mean Distribution
Standard Deviation 143.1536
95.00% Confidence Intervall ( 479442.99 - 480004.14 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1364
0.1 Scale Factor Error with Delta=300 697135
0.05 Scale Factor Error with Delta=300 2788540
0.01 Scale Factor Error with Delta=300 69713480
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 3985
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 818
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 171349554 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

\n\n